NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS87397.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
87397.1 Public Homo sapiens 6 OARD1 24 110 108 CCDS HistoryNCBI Gene:221443Re-query CCDS DB by CCDS ID:87397.1Re-query CCDS DB by GeneID:221443See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 87397.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000373154.6 ENSP00000362247.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373154.6Link to Ensembl Protein Viewer:ENSP00000362247.2Re-query CCDS DB by Nucleotide ID:ENST00000373154Re-query CCDS DB by Protein ID:ENSP00000362247
Original member Current member EBI ENST00000480585.5 ENSP00000418400.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000480585.5Link to Ensembl Protein Viewer:ENSP00000418400.1Re-query CCDS DB by Nucleotide ID:ENST00000480585Re-query CCDS DB by Protein ID:ENSP00000418400
Original member Current member EBI ENST00000628419.2 ENSP00000487484.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000628419.2Link to Ensembl Protein Viewer:ENSP00000487484.1Re-query CCDS DB by Nucleotide ID:ENST00000628419Re-query CCDS DB by Protein ID:ENSP00000487484
Original member Current member NCBI NM_001329690.2 NP_001316619.1 Accepted alive Link to Nucleotide Sequence:NM_001329690.2Link to Protein Sequence:NP_001316619.1Re-query CCDS DB by Nucleotide ID:NM_001329690Re-query CCDS DB by Protein ID:NP_001316619Link to BLAST:NP_001316619.1
Original member Current member NCBI NM_001329691.2 NP_001316620.1 Accepted alive Link to Nucleotide Sequence:NM_001329691.2Link to Protein Sequence:NP_001316620.1Re-query CCDS DB by Nucleotide ID:NM_001329691Re-query CCDS DB by Protein ID:NP_001316620Link to BLAST:NP_001316620.1
Original member Current member NCBI NM_001329692.1 NP_001316621.1 Accepted alive Link to Nucleotide Sequence:NM_001329692.1Link to Protein Sequence:NP_001316621.1Re-query CCDS DB by Nucleotide ID:NM_001329692Re-query CCDS DB by Protein ID:NP_001316621Link to BLAST:NP_001316621.1
Original member Current member NCBI NM_001329693.2 NP_001316622.1 Accepted alive Link to Nucleotide Sequence:NM_001329693.2Link to Protein Sequence:NP_001316622.1Re-query CCDS DB by Nucleotide ID:NM_001329693Re-query CCDS DB by Protein ID:NP_001316622Link to BLAST:NP_001316622.1

Chromosomal Locations for CCDS 87397.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 41067420 41067437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41070076 41070134 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41071132 41071276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 41071596 41071634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (261 nt):
ATGGCCAGCAGCCTTAATGAAGATCCAGAAGGAAGCAGAATCACTTATGTGAAAGGAGACCTTTTTGCAT
GCCCGAAAACAGACTCTTTAGCCCACTGTATCAGTGAGGATTGTCGCATGGGCGCTGGGATAGCTGTCCT
CTTTAAGAAGAAATTTGGAGGGGTGCAAGAACTTTTAAATCAACAAAAGAAATCTGGAGAAGTGGCTGTT
CTGAAGAGAGATGGGCGATATATATATTACTTGGATTGGATGTGGTCTTGA

Translation (86 aa):
MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAV
LKRDGRYIYYLDWMWS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH