NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS8385.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8385.1 Public Homo sapiens 11 FXYD2 24 110 108 CCDS HistoryNCBI Gene:486Re-query CCDS DB by CCDS ID:8385.1Re-query CCDS DB by GeneID:486See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 8385.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000260287.2 ENSP00000260287.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000260287.2Link to Ensembl Protein Viewer:ENSP00000260287.2Re-query CCDS DB by Nucleotide ID:ENST00000260287Re-query CCDS DB by Protein ID:ENSP00000260287
Original member Current member EBI ENST00000528014.5 ENSP00000432430.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000528014.5Link to Ensembl Protein Viewer:ENSP00000432430.1Re-query CCDS DB by Nucleotide ID:ENST00000528014Re-query CCDS DB by Protein ID:ENSP00000432430
Original member Current member EBI ENST00000532119.5 ENSP00000436414.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000532119.5Link to Ensembl Protein Viewer:ENSP00000436414.1Re-query CCDS DB by Nucleotide ID:ENST00000532119Re-query CCDS DB by Protein ID:ENSP00000436414
Original member Current member NCBI NM_021603.4 NP_067614.1 Accepted alive Link to Nucleotide Sequence:NM_021603.4Link to Protein Sequence:NP_067614.1Re-query CCDS DB by Nucleotide ID:NM_021603Re-query CCDS DB by Protein ID:NP_067614Link to BLAST:NP_067614.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067614.1 64 P54710-2 64 100% 0 0

Chromosomal Locations for CCDS 8385.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 117820672 117820696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117820859 117820895 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117822406 117822480 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117822679 117822717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 117827995 117828013 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (195 nt):
ATGGACAGGTGGTACCTGGGCGGCAGCCCCAAGGGGGACGTGGACCCGTTCTACTATGACTATGAGACCG
TTCGCAATGGGGGCCTGATCTTCGCTGGACTGGCCTTCATCGTGGGGCTCCTCATCCTCCTCAGCAGAAG
ATTCCGCTGTGGGGGCAATAAGAAGCGCAGGCAAATCAATGAAGATGAGCCGTAA

Translation (64 aa):
MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH