NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS13014.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13014.1 Public Homo sapiens 20 FKBP1A 24 110 108 CCDS HistoryNCBI Gene:2280Re-query CCDS DB by CCDS ID:13014.1Re-query CCDS DB by GeneID:2280See the combined annotation on chromosome 20 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 13014.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000381719.8 ENSP00000371138.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381719.8Link to Ensembl Protein Viewer:ENSP00000371138.3Re-query CCDS DB by Nucleotide ID:ENST00000381719Re-query CCDS DB by Protein ID:ENSP00000371138
Original member Current member EBI ENST00000381724.8 ENSP00000371143.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000381724.8Link to Ensembl Protein Viewer:ENSP00000371143.4Re-query CCDS DB by Nucleotide ID:ENST00000381724Re-query CCDS DB by Protein ID:ENSP00000371143
Original member Current member EBI ENST00000400137.9 ENSP00000383003.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000400137.9Link to Ensembl Protein Viewer:ENSP00000383003.4Re-query CCDS DB by Nucleotide ID:ENST00000400137Re-query CCDS DB by Protein ID:ENSP00000383003
Original member Current member EBI ENST00000677335.1 ENSP00000503033.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000677335.1Link to Ensembl Protein Viewer:ENSP00000503033.1Re-query CCDS DB by Nucleotide ID:ENST00000677335Re-query CCDS DB by Protein ID:ENSP00000503033
Original member Current member EBI ENST00000678408.1 ENSP00000503152.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000678408.1Link to Ensembl Protein Viewer:ENSP00000503152.1Re-query CCDS DB by Nucleotide ID:ENST00000678408Re-query CCDS DB by Protein ID:ENSP00000503152
Original member Current member NCBI NM_000801.5 NP_000792.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_000801.5Link to Protein Sequence:NP_000792.1Re-query CCDS DB by Nucleotide ID:NM_000801Re-query CCDS DB by Protein ID:NP_000792Link to BLAST:NP_000792.1
Original member Current member NCBI NM_054014.4 NP_463460.1 Accepted alive Link to Nucleotide Sequence:NM_054014.4Link to Protein Sequence:NP_463460.1Re-query CCDS DB by Nucleotide ID:NM_054014Re-query CCDS DB by Protein ID:NP_463460Link to BLAST:NP_463460.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000792.1 108 P62942 108 100% 0 0
NP_463460.1 108 P62942 108 100% 0 0

Chromosomal Locations for CCDS 13014.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 20 (NC_000020.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20See the combined annotation on chromosome 20 in Sequence Viewer

Chromosome Start Stop Links
20 1372112 1372240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 1375491 1375603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 1392834 1392881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20
20 1392962 1392998 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 20Link to Ensembl Genome Browser on chromosome 20

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (327 nt):
ATGGGAGTGCAGGTGGAAACCATCTCCCCAGGAGACGGGCGCACCTTCCCCAAGCGCGGCCAGACCTGCG
TGGTGCACTACACCGGGATGCTTGAAGATGGAAAGAAATTTGATTCCTCCCGGGACAGAAACAAGCCCTT
TAAGTTTATGCTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAAGAAGGGGTTGCCCAGATGAGTGTGGGT
CAGAGAGCCAAACTGACTATATCTCCAGATTATGCCTATGGTGCCACTGGGCACCCAGGCATCATCCCAC
CACATGCCACTCTCGTCTTCGATGTGGAGCTTCTAAAACTGGAATGA

Translation (108 aa):
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVG
QRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH