NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS60486.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
60486.1 Public Homo sapiens 10 FAM107B 24 110 108 CCDS HistoryNCBI Gene:83641Re-query CCDS DB by CCDS ID:60486.1Re-query CCDS DB by GeneID:83641See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 60486.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000378458.6 ENSP00000367719.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378458.6Link to Ensembl Protein Viewer:ENSP00000367719.2Re-query CCDS DB by Nucleotide ID:ENST00000378458Re-query CCDS DB by Protein ID:ENSP00000367719
Original member Current member EBI ENST00000378462.5 ENSP00000367723.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378462.5Link to Ensembl Protein Viewer:ENSP00000367723.1Re-query CCDS DB by Nucleotide ID:ENST00000378462Re-query CCDS DB by Protein ID:ENSP00000367723
Original member Current member EBI ENST00000378465.7 ENSP00000367726.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378465.7Link to Ensembl Protein Viewer:ENSP00000367726.3Re-query CCDS DB by Nucleotide ID:ENST00000378465Re-query CCDS DB by Protein ID:ENSP00000367726
Original member Current member EBI ENST00000378467.8 ENSP00000367728.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378467.8Link to Ensembl Protein Viewer:ENSP00000367728.4Re-query CCDS DB by Nucleotide ID:ENST00000378467Re-query CCDS DB by Protein ID:ENSP00000367728
Original member Current member EBI ENST00000378470.5 ENSP00000367731.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378470.5Link to Ensembl Protein Viewer:ENSP00000367731.1Re-query CCDS DB by Nucleotide ID:ENST00000378470Re-query CCDS DB by Protein ID:ENSP00000367731
Original member Current member EBI ENST00000478076.5 ENSP00000417782.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000478076.5Link to Ensembl Protein Viewer:ENSP00000417782.1Re-query CCDS DB by Nucleotide ID:ENST00000478076Re-query CCDS DB by Protein ID:ENSP00000417782
Original member Current member EBI ENST00000468747.5 ENSP00000418120.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000468747.5Link to Ensembl Protein Viewer:ENSP00000418120.1Re-query CCDS DB by Nucleotide ID:ENST00000468747Re-query CCDS DB by Protein ID:ENSP00000418120
Original member Current member EBI ENST00000496330.5 ENSP00000418330.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000496330.5Link to Ensembl Protein Viewer:ENSP00000418330.1Re-query CCDS DB by Nucleotide ID:ENST00000496330Re-query CCDS DB by Protein ID:ENSP00000418330
Original member Current member EBI ENST00000479731.5 ENSP00000419603.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000479731.5Link to Ensembl Protein Viewer:ENSP00000419603.1Re-query CCDS DB by Nucleotide ID:ENST00000479731Re-query CCDS DB by Protein ID:ENSP00000419603
Original member Current member EBI ENST00000622567.4 ENSP00000479842.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000622567.4Link to Ensembl Protein Viewer:ENSP00000479842.1Re-query CCDS DB by Nucleotide ID:ENST00000622567Re-query CCDS DB by Protein ID:ENSP00000479842
Original member Current member NCBI NM_001282695.2 NP_001269624.1 Accepted alive Link to Nucleotide Sequence:NM_001282695.2Link to Protein Sequence:NP_001269624.1Re-query CCDS DB by Nucleotide ID:NM_001282695Re-query CCDS DB by Protein ID:NP_001269624Link to BLAST:NP_001269624.1
Original member Current member NCBI NM_001282696.2 NP_001269625.1 Accepted alive Link to Nucleotide Sequence:NM_001282696.2Link to Protein Sequence:NP_001269625.1Re-query CCDS DB by Nucleotide ID:NM_001282696Re-query CCDS DB by Protein ID:NP_001269625Link to BLAST:NP_001269625.1
Original member Current member NCBI NM_001282697.2 NP_001269626.1 Accepted alive Link to Nucleotide Sequence:NM_001282697.2Link to Protein Sequence:NP_001269626.1Re-query CCDS DB by Nucleotide ID:NM_001282697Re-query CCDS DB by Protein ID:NP_001269626Link to BLAST:NP_001269626.1
Original member Current member NCBI NM_001282698.2 NP_001269627.1 Accepted alive Link to Nucleotide Sequence:NM_001282698.2Link to Protein Sequence:NP_001269627.1Re-query CCDS DB by Nucleotide ID:NM_001282698Re-query CCDS DB by Protein ID:NP_001269627Link to BLAST:NP_001269627.1
Original member Current member NCBI NM_001282699.1 NP_001269628.1 Accepted alive Link to Nucleotide Sequence:NM_001282699.1Link to Protein Sequence:NP_001269628.1Re-query CCDS DB by Nucleotide ID:NM_001282699Re-query CCDS DB by Protein ID:NP_001269628Link to BLAST:NP_001269628.1
Original member Current member NCBI NM_001282700.2 NP_001269629.1 Accepted alive Link to Nucleotide Sequence:NM_001282700.2Link to Protein Sequence:NP_001269629.1Re-query CCDS DB by Nucleotide ID:NM_001282700Re-query CCDS DB by Protein ID:NP_001269629Link to BLAST:NP_001269629.1
Original member Current member NCBI NM_001282701.2 NP_001269630.1 Accepted alive Link to Nucleotide Sequence:NM_001282701.2Link to Protein Sequence:NP_001269630.1Re-query CCDS DB by Nucleotide ID:NM_001282701Re-query CCDS DB by Protein ID:NP_001269630Link to BLAST:NP_001269630.1
Original member Current member NCBI NM_001282702.2 NP_001269631.1 Accepted alive Link to Nucleotide Sequence:NM_001282702.2Link to Protein Sequence:NP_001269631.1Re-query CCDS DB by Nucleotide ID:NM_001282702Re-query CCDS DB by Protein ID:NP_001269631Link to BLAST:NP_001269631.1
Original member Current member NCBI NM_001282703.1 NP_001269632.1 Accepted alive Link to Nucleotide Sequence:NM_001282703.1Link to Protein Sequence:NP_001269632.1Re-query CCDS DB by Nucleotide ID:NM_001282703Re-query CCDS DB by Protein ID:NP_001269632Link to BLAST:NP_001269632.1
Original member Current member NCBI NM_001320735.2 NP_001307664.1 Accepted alive Link to Nucleotide Sequence:NM_001320735.2Link to Protein Sequence:NP_001307664.1Re-query CCDS DB by Nucleotide ID:NM_001320735Re-query CCDS DB by Protein ID:NP_001307664Link to BLAST:NP_001307664.1
Original member Current member NCBI NM_001320736.2 NP_001307665.1 Accepted alive Link to Nucleotide Sequence:NM_001320736.2Link to Protein Sequence:NP_001307665.1Re-query CCDS DB by Nucleotide ID:NM_001320736Re-query CCDS DB by Protein ID:NP_001307665Link to BLAST:NP_001307665.1
Original member Current member NCBI NM_001320737.1 NP_001307666.1 Accepted alive Link to Nucleotide Sequence:NM_001320737.1Link to Protein Sequence:NP_001307666.1Re-query CCDS DB by Nucleotide ID:NM_001320737Re-query CCDS DB by Protein ID:NP_001307666Link to BLAST:NP_001307666.1
Original member Current member NCBI NM_001320738.2 NP_001307667.1 Accepted alive Link to Nucleotide Sequence:NM_001320738.2Link to Protein Sequence:NP_001307667.1Re-query CCDS DB by Nucleotide ID:NM_001320738Re-query CCDS DB by Protein ID:NP_001307667Link to BLAST:NP_001307667.1
Original member Current member NCBI NM_001320739.2 NP_001307668.1 Accepted alive Link to Nucleotide Sequence:NM_001320739.2Link to Protein Sequence:NP_001307668.1Re-query CCDS DB by Nucleotide ID:NM_001320739Re-query CCDS DB by Protein ID:NP_001307668Link to BLAST:NP_001307668.1
Original member Current member NCBI NM_001320740.1 NP_001307669.1 Accepted alive Link to Nucleotide Sequence:NM_001320740.1Link to Protein Sequence:NP_001307669.1Re-query CCDS DB by Nucleotide ID:NM_001320740Re-query CCDS DB by Protein ID:NP_001307669Link to BLAST:NP_001307669.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001269624.1 131 Q9H098-1 131 100% 0 0
NP_001269625.1 131 Q9H098-1 131 100% 0 0
NP_001269626.1 131 Q9H098-1 131 100% 0 0
NP_001269627.1 131 Q9H098-1 131 100% 0 0
NP_001269628.1 131 Q9H098-1 131 100% 0 0
NP_001269629.1 131 Q9H098-1 131 100% 0 0
NP_001269630.1 131 Q9H098-1 131 100% 0 0
NP_001269631.1 131 Q9H098-1 131 100% 0 0
NP_001269632.1 131 Q9H098-1 131 100% 0 0
NP_001307664.1 131 Q9H098-1 131 100% 0 0
NP_001307665.1 131 Q9H098-1 131 100% 0 0
NP_001307666.1 131 Q9H098-1 131 100% 0 0
NP_001307667.1 131 Q9H098-1 131 100% 0 0
NP_001307668.1 131 Q9H098-1 131 100% 0 0
NP_001307669.1 131 Q9H098-1 131 100% 0 0

Chromosomal Locations for CCDS 60486.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 14521190 14521306 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 14521869 14522019 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 14530332 14530459 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (396 nt):
ATGGCCGAGCCAGACTACATAGAAGATGACAATCCTGAACTCATTAGGCCTCAGAAACTGATCAATCCTG
TAAAAACCTCCCGGAACCATCAAGATCTTCACAGAGAACTTCTTATGAATCAAAAAAGGGGTCTTGCTCC
TCAGAACAAACCAGAATTGCAGAAGGTGATGGAAAAAAGAAAACGAGACCAAGTAATAAAGCAGAAGGAA
GAAGAAGCACAGAAGAAGAAATCTGACTTGGAAATAGAGCTATTAAAACGGCAGCAGAAGTTGGAGCAGC
TTGAACTTGAGAAGCAGAAATTGCAAGAAGAGCAAGAAAATGCCCCCGAGTTTGTGAAGGTGAAAGGCAA
TCTCAGGAGAACAGGCCAAGAAGTCGCCCAAGCCCAGGAGTCCTAG

Translation (131 aa):
MAEPDYIEDDNPELIRPQKLINPVKTSRNHQDLHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKE
EEAQKKKSDLEIELLKRQQKLEQLELEKQKLQEEQENAPEFVKVKGNLRRTGQEVAQAQES


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH