NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS81467.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
81467.1 Public Homo sapiens 10 MRLN 24 110 108 CCDS HistoryNCBI Gene:100507027Re-query CCDS DB by CCDS ID:81467.1See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 81467.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000430431.5 ENSP00000488299.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000430431.5Link to Ensembl Protein Viewer:ENSP00000488299.1Re-query CCDS DB by Nucleotide ID:ENST00000430431Re-query CCDS DB by Protein ID:ENSP00000488299
Original member Current member EBI ENST00000628562.1 ENSP00000488429.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000628562.1Link to Ensembl Protein Viewer:ENSP00000488429.1Re-query CCDS DB by Nucleotide ID:ENST00000628562Re-query CCDS DB by Protein ID:ENSP00000488429
Original member Current member EBI ENST00000594536.5 ENSP00000488584.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000594536.5Link to Ensembl Protein Viewer:ENSP00000488584.1Re-query CCDS DB by Nucleotide ID:ENST00000594536Re-query CCDS DB by Protein ID:ENSP00000488584
Original member Current member EBI ENST00000414264.6 ENSP00000488748.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000414264.6Link to Ensembl Protein Viewer:ENSP00000488748.1Re-query CCDS DB by Nucleotide ID:ENST00000414264Re-query CCDS DB by Protein ID:ENSP00000488748
Original member Current member NCBI NM_001304731.2 NP_001291660.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001304731.2Link to Protein Sequence:NP_001291660.1Re-query CCDS DB by Nucleotide ID:NM_001304731Re-query CCDS DB by Protein ID:NP_001291660Link to BLAST:NP_001291660.1
Original member Current member NCBI NM_001304732.2 NP_001291661.1 Accepted alive Link to Nucleotide Sequence:NM_001304732.2Link to Protein Sequence:NP_001291661.1Re-query CCDS DB by Nucleotide ID:NM_001304732Re-query CCDS DB by Protein ID:NP_001291661Link to BLAST:NP_001291661.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001291660.1 46 P0DMT0 46 100% 0 0
NP_001291661.1 46 P0DMT0 46 100% 0 0

Chromosomal Locations for CCDS 81467.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 59737060 59737200 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (141 nt):
ATGACTGGTAAAAACTGGATATTAATTTCTACTACTACTCCCAAAAGTCTAGAAGATGAAATTGTGGGAA
GA
CTTCTAAAAATTTTGTTTGTTATCTTTGTTGACTTAATTTCTATTATATATGTTGTGATAACTTCTTA
G


Translation (46 aa):
MTGKNWILISTTTPKSLEDEIVGRLLKILFVIFVDLISIIYVVITS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser