NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS6133.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6133.2 Public Homo sapiens 8 SMIM19 24 110 108 CCDS HistoryNCBI Gene:114926Re-query CCDS DB by CCDS ID:6133.2See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 6133.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript and conservation data.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 6133.2

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000416469.6 ENSP00000390750.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000416469.6Link to Ensembl Protein Viewer:ENSP00000390750.2Re-query CCDS DB by Nucleotide ID:ENST00000416469Re-query CCDS DB by Protein ID:ENSP00000390750
Original member Current member EBI ENST00000438528.7 ENSP00000391549.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000438528.7Link to Ensembl Protein Viewer:ENSP00000391549.2Re-query CCDS DB by Nucleotide ID:ENST00000438528Re-query CCDS DB by Protein ID:ENSP00000391549
Original member Current member EBI ENST00000417410.7 ENSP00000405694.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000417410.7Link to Ensembl Protein Viewer:ENSP00000405694.2Re-query CCDS DB by Nucleotide ID:ENST00000417410Re-query CCDS DB by Protein ID:ENSP00000405694
Original member Current member EBI ENST00000414154.6 ENSP00000408997.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000414154.6Link to Ensembl Protein Viewer:ENSP00000408997.2Re-query CCDS DB by Nucleotide ID:ENST00000414154Re-query CCDS DB by Protein ID:ENSP00000408997
Original member Current member EBI ENST00000490331.2 ENSP00000429586.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000490331.2Link to Ensembl Protein Viewer:ENSP00000429586.1Re-query CCDS DB by Nucleotide ID:ENST00000490331Re-query CCDS DB by Protein ID:ENSP00000429586
Original member Current member NCBI NM_001135674.2 NP_001129146.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001135674.2Link to Protein Sequence:NP_001129146.1Re-query CCDS DB by Nucleotide ID:NM_001135674Re-query CCDS DB by Protein ID:NP_001129146Link to BLAST:NP_001129146.1
Original member Current member NCBI NM_001135675.2 NP_001129147.1 Accepted alive Link to Nucleotide Sequence:NM_001135675.2Link to Protein Sequence:NP_001129147.1Re-query CCDS DB by Nucleotide ID:NM_001135675Re-query CCDS DB by Protein ID:NP_001129147Link to BLAST:NP_001129147.1
Original member Current member NCBI NM_001135676.2 NP_001129148.1 Accepted alive Link to Nucleotide Sequence:NM_001135676.2Link to Protein Sequence:NP_001129148.1Re-query CCDS DB by Nucleotide ID:NM_001135676Re-query CCDS DB by Protein ID:NP_001129148Link to BLAST:NP_001129148.1
Original member Current member NCBI NM_138436.4 NP_612445.2 Accepted alive Link to Nucleotide Sequence:NM_138436.4Link to Protein Sequence:NP_612445.2Re-query CCDS DB by Nucleotide ID:NM_138436Re-query CCDS DB by Protein ID:NP_612445Link to BLAST:NP_612445.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001129146.1 107 Q96E16 107 100% 0 0
NP_001129147.1 107 Q96E16 107 100% 0 0
NP_001129148.1 107 Q96E16 107 100% 0 0
NP_612445.2 107 Q96E16 107 100% 0 0

Chromosomal Locations for CCDS 6133.2

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 42546473 42546606 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 42548656 42548780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 42552544 42552608 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (324 nt):
ATGGCTGGGGGTTATGGAGTGATGGGTGACGATGGTTCTATTGATTATACTGTTCACGAAGCCTGGAATG
AA
GCCACCAATGTTTACTTGATAGTTATCCTTGTTAGCTTCGGTCTCTTCATGTATGCCAAAAGGAACAA
A
AGGAGAATTATGAGGATATTCAGTGTGCCACCTACAGAGGAAACTTTGTCAGAGCCCAACTTTTATGAC
ACG
ATAAGCAAGATTCGTTTAAGACAACAACTGGAAATGTATTCCATTTCAAGAAAGTACGACTATCAGC
AG
CCACAAAACCAAGCTGACAGTGTGCAACTCTCATTGGAATGA


Translation (107 aa):
MAGGYGVMGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTEETLSEPNFYD
T
ISKIRLRQQLEMYSI
SRKYDYQQPQNQADSVQLSLE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser