NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS55255.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
55255.1 Public Homo sapiens 8 RBIS 24 110 108 CCDS HistoryNCBI Gene:401466Re-query CCDS DB by CCDS ID:55255.1Re-query CCDS DB by GeneID:401466See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 55255.1
The coding region was updated to include a 6-nt insertion found in the GRCh38 reference genome assembly and in aligning transcripts, resulting in two extra amino acids in the protein C-terminus.

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 55255.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000612809.4 ENSP00000481745.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000612809.4Link to Ensembl Protein Viewer:ENSP00000481745.1Re-query CCDS DB by Nucleotide ID:ENST00000612809Re-query CCDS DB by Protein ID:ENSP00000481745
Original member Current member EBI ENST00000615697.4 ENSP00000482944.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000615697.4Link to Ensembl Protein Viewer:ENSP00000482944.1Re-query CCDS DB by Nucleotide ID:ENST00000615697Re-query CCDS DB by Protein ID:ENSP00000482944
Original member Current member EBI ENST00000612977.4 ENSP00000484101.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000612977.4Link to Ensembl Protein Viewer:ENSP00000484101.1Re-query CCDS DB by Nucleotide ID:ENST00000612977Re-query CCDS DB by Protein ID:ENSP00000484101
Original member Current member EBI ENST00000619594.5 ENSP00000484492.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000619594.5Link to Ensembl Protein Viewer:ENSP00000484492.1Re-query CCDS DB by Nucleotide ID:ENST00000619594Re-query CCDS DB by Protein ID:ENSP00000484492
Original member Current member EBI ENST00000611854.4 ENSP00000484811.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000611854.4Link to Ensembl Protein Viewer:ENSP00000484811.1Re-query CCDS DB by Nucleotide ID:ENST00000611854Re-query CCDS DB by Protein ID:ENSP00000484811
Original member Current member NCBI NM_001099670.3 NP_001093140.1 Accepted alive Link to Nucleotide Sequence:NM_001099670.3Link to Protein Sequence:NP_001093140.1Re-query CCDS DB by Nucleotide ID:NM_001099670Re-query CCDS DB by Protein ID:NP_001093140Link to BLAST:NP_001093140.1
Original member Current member NCBI NM_001099671.3 NP_001093141.1 Accepted alive Link to Nucleotide Sequence:NM_001099671.3Link to Protein Sequence:NP_001093141.1Re-query CCDS DB by Nucleotide ID:NM_001099671Re-query CCDS DB by Protein ID:NP_001093141Link to BLAST:NP_001093141.1
Original member Current member NCBI NM_001099672.3 NP_001093142.1 Accepted alive Link to Nucleotide Sequence:NM_001099672.3Link to Protein Sequence:NP_001093142.1Re-query CCDS DB by Nucleotide ID:NM_001099672Re-query CCDS DB by Protein ID:NP_001093142Link to BLAST:NP_001093142.1
Original member Current member NCBI NM_001099673.3 NP_001093143.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001099673.3Link to Protein Sequence:NP_001093143.1Re-query CCDS DB by Nucleotide ID:NM_001099673Re-query CCDS DB by Protein ID:NP_001093143Link to BLAST:NP_001093143.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001093140.1 100 Q8N0T1-1 100 100% 0 0
NP_001093141.1 100 Q8N0T1-1 100 100% 0 0
NP_001093142.1 100 Q8N0T1-1 100 100% 0 0
NP_001093143.1 100 Q8N0T1-1 100 100% 0 0

Chromosomal Locations for CCDS 55255.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 85214560 85214631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 85214921 85215037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 85217386 85217499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (303 nt):
ATGGCCAAGAACAAATTAAGAGGGCCGAAGTCCAGGAATGTATTTCACATAGCCAGCCAAAAAAACTTTA
AGGCTAAAAACAAAGCAAAACCAGTTACCACTAATCTTAAGAAGATAAACATTATGAATGAGGAAAAAGT
TAACAGAGTAAATAAAGCTTTTGTAAATGTACAAAAGGAACTTGCACATTTCGCAAAAAGCATTTCACTT
GAACCTCTGCAGAAAGAACTGATTCCTCAGCAGCGTCATGAAAGCAAACCAGTTAATGTTGATGAAGCTA
CAAGATTAATGGCTCTGTTGTAA

Translation (100 aa):
MAKNKLRGPKSRNVFHIASQKNFKAKNKAKPVTTNLKKINIMNEEKVNRVNKAFVNVQKELAHFAKSISL
EPLQKELIPQQRHESKPVNVDEATRLMALL


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH