NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS45814.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
45814.1 Public Homo sapiens 17 MCRIP1 24 110 108 CCDS HistoryNCBI Gene:348262Re-query CCDS DB by CCDS ID:45814.1Re-query CCDS DB by GeneID:348262See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 6, NCBI annotation release 37.1, Ensembl annotation release 55

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 45814.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000455127.7 ENSP00000409009.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000455127.7Link to Ensembl Protein Viewer:ENSP00000409009.2Re-query CCDS DB by Nucleotide ID:ENST00000455127Re-query CCDS DB by Protein ID:ENSP00000409009
Original member Current member EBI ENST00000538396.5 ENSP00000445543.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000538396.5Link to Ensembl Protein Viewer:ENSP00000445543.1Re-query CCDS DB by Nucleotide ID:ENST00000538396Re-query CCDS DB by Protein ID:ENSP00000445543
Original member Current member EBI ENST00000576730.5 ENSP00000458707.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000576730.5Link to Ensembl Protein Viewer:ENSP00000458707.1Re-query CCDS DB by Nucleotide ID:ENST00000576730Re-query CCDS DB by Protein ID:ENSP00000458707
Original member Current member EBI ENST00000574190.5 ENSP00000458720.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000574190.5Link to Ensembl Protein Viewer:ENSP00000458720.1Re-query CCDS DB by Nucleotide ID:ENST00000574190Re-query CCDS DB by Protein ID:ENSP00000458720
Original member Current member NCBI NM_001093767.3 NP_001087236.1 Accepted alive Link to Nucleotide Sequence:NM_001093767.3Link to Protein Sequence:NP_001087236.1Re-query CCDS DB by Nucleotide ID:NM_001093767Re-query CCDS DB by Protein ID:NP_001087236Link to BLAST:NP_001087236.1
Original member Current member NCBI NM_207368.5 NP_997251.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_207368.5Link to Protein Sequence:NP_997251.2Re-query CCDS DB by Nucleotide ID:NM_207368Re-query CCDS DB by Protein ID:NP_997251Link to BLAST:NP_997251.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001087236.1 97 C9JLW8 97 100% 0 0
NP_997251.2 97 C9JLW8 97 100% 0 0

Chromosomal Locations for CCDS 45814.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 81823247 81823311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 81823412 81823513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 81824287 81824405 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 81824499 81824506 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (294 nt):
ATGACCAGCTCCCCCGTCTCCAGAGTCGTGTACAACGGCAAGAGGACCAGCAGCCCCCGCTCCCCACCCA
GCAGCAGCGAGATCTTCACCCCAGCCCACGAGGAGAACGTCCGCTTCATTTACGAAGCCTGGCAGGGTGT
GGAGCGAGACCTGCGAGGCCAGGTGCCGGGTGGCGAGCGGGGCCTGGTGGAGGAGTATGTGGAGAAGGTC
CCTAACCCCAGCCTGAAGACCTTCAAGCCCATCGACCTGAGTGACCTGAAGCGCCGGAGCACGCAGGATG
CCAAGAAGTCCTAG

Translation (97 aa):
MTSSPVSRVVYNGKRTSSPRSPPSSSEIFTPAHEENVRFIYEAWQGVERDLRGQVPGGERGLVEEYVEKV
PNPSLKTFKPIDLSDLKRRSTQDAKKS


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH