NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS4105.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4105.1 Public Homo sapiens 5 NREP 24 110 108 CCDS HistoryNCBI Gene:9315Re-query CCDS DB by CCDS ID:4105.1Re-query CCDS DB by GeneID:9315See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4105.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000257435.12 ENSP00000257435.7 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000257435.12Link to Ensembl Protein Viewer:ENSP00000257435.7Re-query CCDS DB by Nucleotide ID:ENST00000257435Re-query CCDS DB by Protein ID:ENSP00000257435
Original member Current member EBI ENST00000379671.7 ENSP00000368993.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000379671.7Link to Ensembl Protein Viewer:ENSP00000368993.3Re-query CCDS DB by Nucleotide ID:ENST00000379671Re-query CCDS DB by Protein ID:ENSP00000368993
Original member Current member EBI ENST00000455559.6 ENSP00000392559.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000455559.6Link to Ensembl Protein Viewer:ENSP00000392559.2Re-query CCDS DB by Nucleotide ID:ENST00000455559Re-query CCDS DB by Protein ID:ENSP00000392559
Original member Current member EBI ENST00000419114.6 ENSP00000399766.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000419114.6Link to Ensembl Protein Viewer:ENSP00000399766.2Re-query CCDS DB by Nucleotide ID:ENST00000419114Re-query CCDS DB by Protein ID:ENSP00000399766
Original member Current member EBI ENST00000446294.6 ENSP00000402965.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000446294.6Link to Ensembl Protein Viewer:ENSP00000402965.2Re-query CCDS DB by Nucleotide ID:ENST00000446294Re-query CCDS DB by Protein ID:ENSP00000402965
Original member Current member EBI ENST00000453526.6 ENSP00000403383.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000453526.6Link to Ensembl Protein Viewer:ENSP00000403383.2Re-query CCDS DB by Nucleotide ID:ENST00000453526Re-query CCDS DB by Protein ID:ENSP00000403383
Original member Current member EBI ENST00000447165.6 ENSP00000408839.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000447165.6Link to Ensembl Protein Viewer:ENSP00000408839.2Re-query CCDS DB by Nucleotide ID:ENST00000447165Re-query CCDS DB by Protein ID:ENSP00000408839
Original member Current member EBI ENST00000450761.6 ENSP00000416617.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000450761.6Link to Ensembl Protein Viewer:ENSP00000416617.2Re-query CCDS DB by Nucleotide ID:ENST00000450761Re-query CCDS DB by Protein ID:ENSP00000416617
Original member Current member EBI ENST00000509427.5 ENSP00000422630.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000509427.5Link to Ensembl Protein Viewer:ENSP00000422630.1Re-query CCDS DB by Nucleotide ID:ENST00000509427Re-query CCDS DB by Protein ID:ENSP00000422630
Original member Current member EBI ENST00000508870.5 ENSP00000427149.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000508870.5Link to Ensembl Protein Viewer:ENSP00000427149.1Re-query CCDS DB by Nucleotide ID:ENST00000508870Re-query CCDS DB by Protein ID:ENSP00000427149
Original member Current member NCBI NM_001142476.1 NP_001135948.1 Accepted alive Link to Nucleotide Sequence:NM_001142476.1Link to Protein Sequence:NP_001135948.1Re-query CCDS DB by Nucleotide ID:NM_001142476Re-query CCDS DB by Protein ID:NP_001135948Link to BLAST:NP_001135948.1
Original member Current member NCBI NM_001142477.1 NP_001135949.1 Accepted alive Link to Nucleotide Sequence:NM_001142477.1Link to Protein Sequence:NP_001135949.1Re-query CCDS DB by Nucleotide ID:NM_001142477Re-query CCDS DB by Protein ID:NP_001135949Link to BLAST:NP_001135949.1
Original member Current member NCBI NM_001142478.2 NP_001135950.1 Accepted alive Link to Nucleotide Sequence:NM_001142478.2Link to Protein Sequence:NP_001135950.1Re-query CCDS DB by Nucleotide ID:NM_001142478Re-query CCDS DB by Protein ID:NP_001135950Link to BLAST:NP_001135950.1
Original member Current member NCBI NM_001142479.1 NP_001135951.1 Accepted alive Link to Nucleotide Sequence:NM_001142479.1Link to Protein Sequence:NP_001135951.1Re-query CCDS DB by Nucleotide ID:NM_001142479Re-query CCDS DB by Protein ID:NP_001135951Link to BLAST:NP_001135951.1
Original member Current member NCBI NM_001142480.1 NP_001135952.1 Accepted alive Link to Nucleotide Sequence:NM_001142480.1Link to Protein Sequence:NP_001135952.1Re-query CCDS DB by Nucleotide ID:NM_001142480Re-query CCDS DB by Protein ID:NP_001135952Link to BLAST:NP_001135952.1
Original member Current member NCBI NM_001142481.1 NP_001135953.1 Accepted alive Link to Nucleotide Sequence:NM_001142481.1Link to Protein Sequence:NP_001135953.1Re-query CCDS DB by Nucleotide ID:NM_001142481Re-query CCDS DB by Protein ID:NP_001135953Link to BLAST:NP_001135953.1
Original member Current member NCBI NM_001142482.1 NP_001135954.1 Accepted alive Link to Nucleotide Sequence:NM_001142482.1Link to Protein Sequence:NP_001135954.1Re-query CCDS DB by Nucleotide ID:NM_001142482Re-query CCDS DB by Protein ID:NP_001135954Link to BLAST:NP_001135954.1
Original member Current member NCBI NM_001142483.1 NP_001135955.1 Accepted alive Link to Nucleotide Sequence:NM_001142483.1Link to Protein Sequence:NP_001135955.1Re-query CCDS DB by Nucleotide ID:NM_001142483Re-query CCDS DB by Protein ID:NP_001135955Link to BLAST:NP_001135955.1
Original member Current member NCBI NM_004772.4 NP_004763.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_004772.4Link to Protein Sequence:NP_004763.1Re-query CCDS DB by Nucleotide ID:NM_004772Re-query CCDS DB by Protein ID:NP_004763Link to BLAST:NP_004763.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001135948.1 68 Q16612-1 68 100% 0 0
NP_001135949.1 68 Q16612-1 68 100% 0 0
NP_001135950.1 68 Q16612-1 68 100% 0 0
NP_001135951.1 68 Q16612-1 68 100% 0 0
NP_001135952.1 68 Q16612-1 68 100% 0 0
NP_001135953.1 68 Q16612-1 68 100% 0 0
NP_001135954.1 68 Q16612-1 68 100% 0 0
NP_001135955.1 68 Q16612-1 68 100% 0 0
NP_004763.1 68 Q16612-1 68 100% 0 0

Chromosomal Locations for CCDS 4105.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 111730921 111731046 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 111735430 111735507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 111755770 111755772 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (207 nt):
ATGGTTTATTACCCAGAACTCTTTGTCTGGGTCAGTCAAGAACCATTTCCAAACAAGGACATGGAGGGAA
GGCTTCCTAAGGGAAGACTTCCTGTCCCAAAGGAAGTGAACCGCAAGAAGAACGATGAGACAAACGCTGC
CTCCCTGACTCCACTGGGCAGCAGTGAACTCCGCTCCCCAAGAATCAGTTACCTCCACTTTTTTTAA

Translation (68 aa):
MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH