NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS94476.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
94476.1 Public Homo sapiens 9 GGTA1 24 110 108 CCDS HistoryNCBI Gene:2681Re-query CCDS DB by CCDS ID:94476.1Re-query CCDS DB by GeneID:2681See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 24, NCBI annotation release 110, Ensembl annotation release 108

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 94476.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000481799.6 ENSP00000502991.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000481799.6Link to Ensembl Protein Viewer:ENSP00000502991.1Re-query CCDS DB by Nucleotide ID:ENST00000481799Re-query CCDS DB by Protein ID:ENSP00000502991
Original member Current member EBI ENST00000373793.3 ENSP00000504423.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373793.3Link to Ensembl Protein Viewer:ENSP00000504423.1Re-query CCDS DB by Nucleotide ID:ENST00000373793Re-query CCDS DB by Protein ID:ENSP00000504423
Original member Current member EBI ENST00000495328.5 ENSP00000504776.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000495328.5Link to Ensembl Protein Viewer:ENSP00000504776.1Re-query CCDS DB by Nucleotide ID:ENST00000495328Re-query CCDS DB by Protein ID:ENSP00000504776
Original member Current member NCBI NM_001382584.1 NP_001369513.1 Accepted alive Link to Nucleotide Sequence:NM_001382584.1Link to Protein Sequence:NP_001369513.1Re-query CCDS DB by Nucleotide ID:NM_001382584Re-query CCDS DB by Protein ID:NP_001369513Link to BLAST:NP_001369513.1
Original member Current member NCBI NM_001382585.1 NP_001369514.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001382585.1Link to Protein Sequence:NP_001369514.1Re-query CCDS DB by Nucleotide ID:NM_001382585Re-query CCDS DB by Protein ID:NP_001369514Link to BLAST:NP_001369514.1
Original member Current member NCBI NM_001382586.1 NP_001369515.1 Accepted alive Link to Nucleotide Sequence:NM_001382586.1Link to Protein Sequence:NP_001369515.1Re-query CCDS DB by Nucleotide ID:NM_001382586Re-query CCDS DB by Protein ID:NP_001369515Link to BLAST:NP_001369515.1
Original member Current member NCBI NM_001382587.1 NP_001369516.1 Accepted alive Link to Nucleotide Sequence:NM_001382587.1Link to Protein Sequence:NP_001369516.1Re-query CCDS DB by Nucleotide ID:NM_001382587Re-query CCDS DB by Protein ID:NP_001369516Link to BLAST:NP_001369516.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001369513.1 100 Q4G0N0 100 100% 0 0
NP_001369514.1 100 Q4G0N0 100 100% 0 0
NP_001369515.1 100 Q4G0N0 100 100% 0 0
NP_001369516.1 100 Q4G0N0 100 100% 0 0

Chromosomal Locations for CCDS 94476.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 121455837 121455841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 121460104 121460219 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 121461252 121461317 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 121463293 121463328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 121467843 121467922 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (303 nt):
ATGAATGTCAAAGGAAAAGTAATTCTGTCAATGCTGGTTGTCTCAACTGTGATCATTGTGTTTTGGGAAT
TTATCAACAGCACAGAAGGCTCTTTCTTGTGGATATATCACTCAAAAAACCCAGAAGTTGATGACAGCAG
TGCTCAGAAGGGCTGGTGGTTTCTGAGCTGGTTTAACAATGGGATCCACAATTATCAACAAGGGGAAGAA
GACATAGACAAAGAAAAAGGAAGAGAGGAGACCAAAGGAAGGAAAATGACACAACAGAGCTTCGGCTATG
GGACTGGTTTAATCCAAACTTGA

Translation (100 aa):
MNVKGKVILSMLVVSTVIIVFWEFINSTEGSFLWIYHSKNPEVDDSSAQKGWWFLSWFNNGIHNYQQGEE
DIDKEKGREETKGRKMTQQSFGYGTGLIQT


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH