NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS33565.3 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
33565.3 Public Homo sapiens 21 TFF3 24 110 108 CCDS HistoryNCBI Gene:7033Re-query CCDS DB by CCDS ID:33565.3See the combined annotation on chromosome 21 in Sequence Viewer

Public Note for CCDS 33565.1
The coding region has been updated to shorten the N-terminus by 36 aa to one that is more supported by the available protein data. Use of the previously represented upstream start codon eliminates an N-terminal signal peptide, whose presence is consistent with publication data showing this to be a secreted protein. Both the upstream and the downstream start codons have weak Kozak signals and are restricted to primate species. The existence of another alternative downstream start codon, which has a strong Kozak signal and is much more widely conserved, should also be noted. It is possible that leaky scanning by ribosomes may allow this alternative start codon to be used some of the time. This would result in a protein that is 21 aa shorter at the N-terminus. There is no experimental evidence indicating which start codon is preferentially used in vivo.

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 33565.3

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000518498.3 ENSP00000430690.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000518498.3Link to Ensembl Protein Viewer:ENSP00000430690.2Re-query CCDS DB by Nucleotide ID:ENST00000518498Re-query CCDS DB by Protein ID:ENSP00000430690
Original member Current member NCBI NM_003226.4 NP_003217.4 MANE Select Accepted alive Link to Nucleotide Sequence:NM_003226.4Link to Protein Sequence:NP_003217.4Re-query CCDS DB by Nucleotide ID:NM_003226Re-query CCDS DB by Protein ID:NP_003217Link to BLAST:NP_003217.4

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003217.4 80 Q07654 80 100% 0 0

Chromosomal Locations for CCDS 33565.3

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 42312256 42312269 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 42313485 42313631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21
21 42315293 42315374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (243 nt):
ATGGCTGCCAGAGCGCTCTGCATGCTGGGGCTGGTCCTGGCCTTGCTGTCCTCCAGCTCTGCTGAGGAGT
ACGTGGGCCTGTCTGCAAACCAGTGTGCCGTGCCAGCCAAGGACAGGGTGGACTGCGGCTACCCCCATGT
CACCCCCAAGGAGTGCAACAACCGGGGCTGCTGCTTTGACTCCAGGATCCCTGGAGTGCCTTGGTGTTTC
AAGCCCCTGCAGGAAGCAGAATGCACCTTCTGA

Translation (80 aa):
MAARALCMLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCF
KPLQEAECTF


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH