NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS8800.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
8800.1 Public Homo sapiens 12 COX14 24 110 108 CCDS HistoryNCBI Gene:84987Re-query CCDS DB by CCDS ID:8800.1See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 8800.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000317943.6 ENSP00000326052.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000317943.6Link to Ensembl Protein Viewer:ENSP00000326052.2Re-query CCDS DB by Nucleotide ID:ENST00000317943Re-query CCDS DB by Protein ID:ENSP00000326052
Original member Current member EBI ENST00000550487.6 ENSP00000446524.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000550487.6Link to Ensembl Protein Viewer:ENSP00000446524.1Re-query CCDS DB by Nucleotide ID:ENST00000550487Re-query CCDS DB by Protein ID:ENSP00000446524
Original member Current member EBI ENST00000548985.1 ENSP00000447776.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000548985.1Link to Ensembl Protein Viewer:ENSP00000447776.1Re-query CCDS DB by Nucleotide ID:ENST00000548985Re-query CCDS DB by Protein ID:ENSP00000447776
Original member Current member EBI ENST00000550654.1 ENSP00000450331.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000550654.1Link to Ensembl Protein Viewer:ENSP00000450331.1Re-query CCDS DB by Nucleotide ID:ENST00000550654Re-query CCDS DB by Protein ID:ENSP00000450331
Original member Current member NCBI NM_001257133.2 NP_001244062.1 Accepted alive Link to Nucleotide Sequence:NM_001257133.2Link to Protein Sequence:NP_001244062.1Re-query CCDS DB by Nucleotide ID:NM_001257133Re-query CCDS DB by Protein ID:NP_001244062Link to BLAST:NP_001244062.1
Original member Current member NCBI NM_001257134.2 NP_001244063.1 Accepted alive Link to Nucleotide Sequence:NM_001257134.2Link to Protein Sequence:NP_001244063.1Re-query CCDS DB by Nucleotide ID:NM_001257134Re-query CCDS DB by Protein ID:NP_001244063Link to BLAST:NP_001244063.1
Original member Current member NCBI NM_032901.4 NP_116290.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_032901.4Link to Protein Sequence:NP_116290.1Re-query CCDS DB by Nucleotide ID:NM_032901Re-query CCDS DB by Protein ID:NP_116290Link to BLAST:NP_116290.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001244062.1 57 Q96I36 57 100% 0 0
NP_001244063.1 57 Q96I36 57 100% 0 0
NP_116290.1 57 Q96I36 57 100% 0 0

Chromosomal Locations for CCDS 8800.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 50120044 50120217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (174 nt):
ATGCCAACTGGCAAGCAGCTAGCTGACATTGGCTATAAGACCTTCTCTACCTCCATGATGCTTCTCACTG
TG
TATGGGGGGTACCTCTGCAGTGTCCGAGTCTACCACTATTTCCAGTGGCGCAGGGCCCAGCGCCAGGC
C
GCAGAAGAACAGAAGACCTCAGGAATCATGTAG


Translation (57 aa):
MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser