NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS1333.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
1333.1 Public Homo sapiens 1 FAM163A 24 110 108 CCDS HistoryNCBI Gene:148753Re-query CCDS DB by CCDS ID:1333.1Re-query CCDS DB by GeneID:148753See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 1333.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000341785.5 ENSP00000354891.4 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000341785.5Link to Ensembl Protein Viewer:ENSP00000354891.4Re-query CCDS DB by Nucleotide ID:ENST00000341785Re-query CCDS DB by Protein ID:ENSP00000354891
Original member Current member NCBI NM_001329712.2 NP_001316641.1 Accepted alive Link to Nucleotide Sequence:NM_001329712.2Link to Protein Sequence:NP_001316641.1Re-query CCDS DB by Nucleotide ID:NM_001329712Re-query CCDS DB by Protein ID:NP_001316641Link to BLAST:NP_001316641.1
Original member Current member NCBI NM_001329713.2 NP_001316642.1 Accepted alive Link to Nucleotide Sequence:NM_001329713.2Link to Protein Sequence:NP_001316642.1Re-query CCDS DB by Nucleotide ID:NM_001329713Re-query CCDS DB by Protein ID:NP_001316642Link to BLAST:NP_001316642.1
Original member Current member NCBI NM_001329714.2 NP_001316643.1 Accepted alive Link to Nucleotide Sequence:NM_001329714.2Link to Protein Sequence:NP_001316643.1Re-query CCDS DB by Nucleotide ID:NM_001329714Re-query CCDS DB by Protein ID:NP_001316643Link to BLAST:NP_001316643.1
Original member Current member NCBI NM_001329715.2 NP_001316644.1 Accepted alive Link to Nucleotide Sequence:NM_001329715.2Link to Protein Sequence:NP_001316644.1Re-query CCDS DB by Nucleotide ID:NM_001329715Re-query CCDS DB by Protein ID:NP_001316644Link to BLAST:NP_001316644.1
Original member Current member NCBI NM_001329716.2 NP_001316645.1 Accepted alive Link to Nucleotide Sequence:NM_001329716.2Link to Protein Sequence:NP_001316645.1Re-query CCDS DB by Nucleotide ID:NM_001329716Re-query CCDS DB by Protein ID:NP_001316645Link to BLAST:NP_001316645.1
Original member Current member NCBI NM_001329717.2 NP_001316646.1 Accepted alive Link to Nucleotide Sequence:NM_001329717.2Link to Protein Sequence:NP_001316646.1Re-query CCDS DB by Nucleotide ID:NM_001329717Re-query CCDS DB by Protein ID:NP_001316646Link to BLAST:NP_001316646.1
Original member Current member NCBI NM_001329718.2 NP_001316647.1 Accepted alive Link to Nucleotide Sequence:NM_001329718.2Link to Protein Sequence:NP_001316647.1Re-query CCDS DB by Nucleotide ID:NM_001329718Re-query CCDS DB by Protein ID:NP_001316647Link to BLAST:NP_001316647.1
Original member Current member NCBI NM_001329719.2 NP_001316648.1 Accepted alive Link to Nucleotide Sequence:NM_001329719.2Link to Protein Sequence:NP_001316648.1Re-query CCDS DB by Nucleotide ID:NM_001329719Re-query CCDS DB by Protein ID:NP_001316648Link to BLAST:NP_001316648.1
Original member Current member NCBI NM_001393415.1 NP_001380344.1 Accepted alive Link to Nucleotide Sequence:NM_001393415.1Link to Protein Sequence:NP_001380344.1Re-query CCDS DB by Nucleotide ID:NM_001393415Re-query CCDS DB by Protein ID:NP_001380344Link to BLAST:NP_001380344.1
Original member Current member NCBI NM_001393416.1 NP_001380345.1 Accepted alive Link to Nucleotide Sequence:NM_001393416.1Link to Protein Sequence:NP_001380345.1Re-query CCDS DB by Nucleotide ID:NM_001393416Re-query CCDS DB by Protein ID:NP_001380345Link to BLAST:NP_001380345.1
Original member Current member NCBI NM_001393417.1 NP_001380346.1 Accepted alive Link to Nucleotide Sequence:NM_001393417.1Link to Protein Sequence:NP_001380346.1Re-query CCDS DB by Nucleotide ID:NM_001393417Re-query CCDS DB by Protein ID:NP_001380346Link to BLAST:NP_001380346.1
Original member Current member NCBI NM_001393418.1 NP_001380347.1 Accepted alive Link to Nucleotide Sequence:NM_001393418.1Link to Protein Sequence:NP_001380347.1Re-query CCDS DB by Nucleotide ID:NM_001393418Re-query CCDS DB by Protein ID:NP_001380347Link to BLAST:NP_001380347.1
Original member Current member NCBI NM_001393419.1 NP_001380348.1 Accepted alive Link to Nucleotide Sequence:NM_001393419.1Link to Protein Sequence:NP_001380348.1Re-query CCDS DB by Nucleotide ID:NM_001393419Re-query CCDS DB by Protein ID:NP_001380348Link to BLAST:NP_001380348.1
Original member Current member NCBI NM_001393420.1 NP_001380349.1 Accepted alive Link to Nucleotide Sequence:NM_001393420.1Link to Protein Sequence:NP_001380349.1Re-query CCDS DB by Nucleotide ID:NM_001393420Re-query CCDS DB by Protein ID:NP_001380349Link to BLAST:NP_001380349.1
Original member Current member NCBI NM_001393421.1 NP_001380350.1 Accepted alive Link to Nucleotide Sequence:NM_001393421.1Link to Protein Sequence:NP_001380350.1Re-query CCDS DB by Nucleotide ID:NM_001393421Re-query CCDS DB by Protein ID:NP_001380350Link to BLAST:NP_001380350.1
Original member Current member NCBI NM_001393422.1 NP_001380351.1 Accepted alive Link to Nucleotide Sequence:NM_001393422.1Link to Protein Sequence:NP_001380351.1Re-query CCDS DB by Nucleotide ID:NM_001393422Re-query CCDS DB by Protein ID:NP_001380351Link to BLAST:NP_001380351.1
Original member Current member NCBI NM_001393423.1 NP_001380352.1 Accepted alive Link to Nucleotide Sequence:NM_001393423.1Link to Protein Sequence:NP_001380352.1Re-query CCDS DB by Nucleotide ID:NM_001393423Re-query CCDS DB by Protein ID:NP_001380352Link to BLAST:NP_001380352.1
Original member Current member NCBI NM_173509.3 NP_775780.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_173509.3Link to Protein Sequence:NP_775780.1Re-query CCDS DB by Nucleotide ID:NM_173509Re-query CCDS DB by Protein ID:NP_775780Link to BLAST:NP_775780.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001316641.1 167 Q96GL9 167 100% 0 0
NP_001316642.1 167 Q96GL9 167 100% 0 0
NP_001316643.1 167 Q96GL9 167 100% 0 0
NP_001316644.1 167 Q96GL9 167 100% 0 0
NP_001316645.1 167 Q96GL9 167 100% 0 0
NP_001316646.1 167 Q96GL9 167 100% 0 0
NP_001316647.1 167 Q96GL9 167 100% 0 0
NP_001316648.1 167 Q96GL9 167 100% 0 0
NP_001380344.1 167 Q96GL9 167 100% 0 0
NP_001380345.1 167 Q96GL9 167 100% 0 0
NP_001380346.1 167 Q96GL9 167 100% 0 0
NP_001380347.1 167 Q96GL9 167 100% 0 0
NP_001380348.1 167 Q96GL9 167 100% 0 0
NP_001380349.1 167 Q96GL9 167 100% 0 0
NP_001380350.1 167 Q96GL9 167 100% 0 0
NP_001380351.1 167 Q96GL9 167 100% 0 0
NP_001380352.1 167 Q96GL9 167 100% 0 0
NP_775780.1 167 Q96GL9 167 100% 0 0

Chromosomal Locations for CCDS 1333.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 179813098 179813190 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 179813779 179814189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (504 nt):
ATGACAGCGGGAACGGTTGTGATCACTGGCGGAATCCTAGCTACGGTGATCCTCCTCTGCATCATTGCCG
TC
CTGTGCTACTGCAGGCTCCAGTATTACTGCTGCAAGAAGAGCGGAACCGAGGTTGCAGACGAGGAGGA
G
GAGCGGGAGCACGACCTTCCCACGCATCCCAGAGGCCCCACCTGCAATGCCTGCAGCTCCCAAGCCCTG
GAC
GGCAGAGGCAGCCTGGCGCCTCTCACCAGCGAGCCCTGCAGCCAGCCCTGTGGGGTGGCCGCGAGCC
AC
TGCACTACCTGCTCCCCATACAGCTCCCCCTTTTACATACGGACGGCTGACATGGTGCCCAATGGGGG
T
GGAGGCGAGAGGCTCTCCTTTGCTCCCACATACTACAAAGAGGGGGGACCCCCATCCCTCAAATTGGCA
GCA
CCCCAGAGTTACCCGGTGACCTGGCCAGGCTCTGGGCGTGAGGCCTTCACCAATCCAAGGGCTATTA
GT
ACAGACGTGTAA


Translation (167 aa):
MTAGTVVITGGILATVILLCIIAVLCYCRLQYYCCKKSGTEVADEEEEREHDLPTHPRGPTCNACSSQAL
D
GRGSLAPLTSEPCSQPCGVAASHCTTCSPYSSPFYIRTADMVPNGGGGERLSFAPTYYKEGGPPSLKLA
A
PQSYPVTWPGSGREAFTNPRAISTDV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser