NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS32036.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
32036.1 Under review, update Homo sapiens 14 RNASE9 24 110 108 CCDS HistoryNCBI Gene:390443Re-query CCDS DB by CCDS ID:32036.1Re-query CCDS DB by GeneID:390443See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 32036.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000338904.7 ENSP00000340162.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000338904.7Link to Ensembl Protein Viewer:ENSP00000340162.3Re-query CCDS DB by Nucleotide ID:ENST00000338904Re-query CCDS DB by Protein ID:ENSP00000340162
Original member Current member EBI ENST00000429244.6 ENSP00000409504.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000429244.6Link to Ensembl Protein Viewer:ENSP00000409504.2Re-query CCDS DB by Nucleotide ID:ENST00000429244Re-query CCDS DB by Protein ID:ENSP00000409504
Original member Current member EBI ENST00000554964.5 ENSP00000450599.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000554964.5Link to Ensembl Protein Viewer:ENSP00000450599.1Re-query CCDS DB by Nucleotide ID:ENST00000554964Re-query CCDS DB by Protein ID:ENSP00000450599
Original member Current member EBI ENST00000555230.5 ENSP00000450800.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555230.5Link to Ensembl Protein Viewer:ENSP00000450800.1Re-query CCDS DB by Nucleotide ID:ENST00000555230Re-query CCDS DB by Protein ID:ENSP00000450800
Original member Current member EBI ENST00000553541.5 ENSP00000451285.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000553541.5Link to Ensembl Protein Viewer:ENSP00000451285.1Re-query CCDS DB by Nucleotide ID:ENST00000553541Re-query CCDS DB by Protein ID:ENSP00000451285
Original member Current member EBI ENST00000557068.5 ENSP00000451565.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000557068.5Link to Ensembl Protein Viewer:ENSP00000451565.1Re-query CCDS DB by Nucleotide ID:ENST00000557068Re-query CCDS DB by Protein ID:ENSP00000451565
Original member NCBI NM_001001673.3 NP_001001673.2 Updated not alive Link to Nucleotide Sequence:NM_001001673.3Link to Protein Sequence:NP_001001673.2Re-query CCDS DB by Nucleotide ID:NM_001001673Re-query CCDS DB by Protein ID:NP_001001673
Current member NCBI NM_001001673.4 NP_001001673.3 Pending alive Link to Nucleotide Sequence:NM_001001673.4Link to Protein Sequence:NP_001001673.3Re-query CCDS DB by Nucleotide ID:NM_001001673Re-query CCDS DB by Protein ID:NP_001001673Link to BLAST:NP_001001673.3
Original member NCBI NM_001110356.1 NP_001103826.1 Updated not alive Link to Nucleotide Sequence:NM_001110356.1Link to Protein Sequence:NP_001103826.1Re-query CCDS DB by Nucleotide ID:NM_001110356Re-query CCDS DB by Protein ID:NP_001103826
Current member NCBI NM_001110356.2 NP_001103826.2 Pending alive Link to Nucleotide Sequence:NM_001110356.2Link to Protein Sequence:NP_001103826.2Re-query CCDS DB by Nucleotide ID:NM_001110356Re-query CCDS DB by Protein ID:NP_001103826Link to BLAST:NP_001103826.2
Original member NCBI NM_001110357.1 NP_001103827.1 Updated not alive Link to Nucleotide Sequence:NM_001110357.1Link to Protein Sequence:NP_001103827.1Re-query CCDS DB by Nucleotide ID:NM_001110357Re-query CCDS DB by Protein ID:NP_001103827
Current member NCBI NM_001110357.2 NP_001103827.2 Pending alive Link to Nucleotide Sequence:NM_001110357.2Link to Protein Sequence:NP_001103827.2Re-query CCDS DB by Nucleotide ID:NM_001110357Re-query CCDS DB by Protein ID:NP_001103827Link to BLAST:NP_001103827.2
Original member NCBI NM_001289110.1 NP_001276039.1 Updated not alive Link to Nucleotide Sequence:NM_001289110.1Link to Protein Sequence:NP_001276039.1Re-query CCDS DB by Nucleotide ID:NM_001289110Re-query CCDS DB by Protein ID:NP_001276039
Current member NCBI NM_001289110.2 NP_001276039.2 Pending alive Link to Nucleotide Sequence:NM_001289110.2Link to Protein Sequence:NP_001276039.2Re-query CCDS DB by Nucleotide ID:NM_001289110Re-query CCDS DB by Protein ID:NP_001276039Link to BLAST:NP_001276039.2

Chromosomal Locations for CCDS 32036.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 20556452 20557069 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (618 nt):
ATGATGAGAACTCTCATCACCACACACCCACTGCCCCTGCTTCTATTGCCGCAGCAGCTGCTGCAGCTGG
TGCAGTTTCAAGAGGTGGATACAGATTTTGATTTCCCAGAAGAAGATAAAAAAGAAGAATTTGAAGAGTG
TTTGGAAAAATTTTTTAGTACAGGGCCCGCCAGACCACCTACCAAAGAAAAAGTCAAAAGACGTGTCCTT
ATTGAACCTGGAATGCCACTAAATCATATAGAGTACTGTAACCATGAAATCATGGGAAAAAATGTTTACT
ACAAACACCGTTGGGTGGCAGAACATTACTTCCTTCTTATGCAATATGACGAGCTCCAAAAAATCTGTTA
CAACAGATTTGTGCCATGTAAGAATGGAATTAGGAAATGTAACAGGAGCAAAGGTCTTGTAGAAGGAGTG
TATTGTAATTTAACAGAAGCATTTGAAATACCAGCGTGTAAATACGAATCACTTTATAGGAAGGGCTACG
TCCTTATCACTTGTTCATGGCAAAATGAAATGCAAAAACGTATTCCTCATACTATAAATGATCTCGTGGA
GCCACCTGAACACAGAAGTTTCCTCAGTGAGGATGGTGTCTTTGTCATATCGCCCTAG

Translation (205 aa):
MMRTLITTHPLPLLLLPQQLLQLVQFQEVDTDFDFPEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVL
IEPGMPLNHIEYCNHEIMGKNVYYKHRWVAEHYFLLMQYDELQKICYNRFVPCKNGIRKCNRSKGLVEGV
YCNLTEAFEIPACKYESLYRKGYVLITCSWQNEMQKRIPHTINDLVEPPEHRSFLSEDGVFVISP


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH