NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS73116.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
73116.1 Public Homo sapiens 10 PTPN20 24 110 108 CCDS HistoryNCBI Gene:26095Re-query CCDS DB by CCDS ID:73116.1Re-query CCDS DB by GeneID:26095See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 73116.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000374342.6 ENSP00000363462.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000374342.6Link to Ensembl Protein Viewer:ENSP00000363462.3Re-query CCDS DB by Nucleotide ID:ENST00000374342Re-query CCDS DB by Protein ID:ENSP00000363462
Original member Current member EBI ENST00000395722.7 ENSP00000379072.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000395722.7Link to Ensembl Protein Viewer:ENSP00000379072.4Re-query CCDS DB by Nucleotide ID:ENST00000395722Re-query CCDS DB by Protein ID:ENSP00000379072
Original member Current member EBI ENST00000513159.5 ENSP00000477675.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000513159.5Link to Ensembl Protein Viewer:ENSP00000477675.1Re-query CCDS DB by Nucleotide ID:ENST00000513159Re-query CCDS DB by Protein ID:ENSP00000477675
Original member Current member EBI ENST00000513756.5 ENSP00000479990.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000513756.5Link to Ensembl Protein Viewer:ENSP00000479990.1Re-query CCDS DB by Nucleotide ID:ENST00000513756Re-query CCDS DB by Protein ID:ENSP00000479990
Original member Current member EBI ENST00000508715.5 ENSP00000480504.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000508715.5Link to Ensembl Protein Viewer:ENSP00000480504.1Re-query CCDS DB by Nucleotide ID:ENST00000508715Re-query CCDS DB by Protein ID:ENSP00000480504
Original member Current member NCBI NM_001042365.4 NP_001035824.1 Accepted alive Link to Nucleotide Sequence:NM_001042365.4Link to Protein Sequence:NP_001035824.1Re-query CCDS DB by Nucleotide ID:NM_001042365Re-query CCDS DB by Protein ID:NP_001035824Link to BLAST:NP_001035824.1

Chromosomal Locations for CCDS 73116.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 46946579 46946675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 46999912 46999974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 47000676 47000710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (195 nt):
ATGTGGACAGCCAGAGGCCCCTTCAGAAGAGACAGGTGGAGCAGTGAGGATGAGGAGGCTGCAGGGCCAT
CA
CAGGCTCTCTCCCCTCTACTTTCTGTTCAACATCATGGATATAGTGGCCCAAATGAGAGAACAACGTT
C
TGGCATGGTTCAAACGAAGGAGCAGTATCACTTTTGTTACGATATTGTGCTTGA


Translation (64 aa):
MWTARGPFRRDRWSSEDEEAAGPSQALSPLLSVQHHGYSGPNERTTFWHGSNEGAVSLLLRYCA



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser