NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS82461.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
82461.1 Public Homo sapiens 2 SNRPG 24 110 108 CCDS HistoryNCBI Gene:6637Re-query CCDS DB by CCDS ID:82461.1Re-query CCDS DB by GeneID:6637See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 20, NCBI annotation release 108, Ensembl annotation release 85

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 82461.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000449935.6 ENSP00000391403.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000449935.6Link to Ensembl Protein Viewer:ENSP00000391403.2Re-query CCDS DB by Nucleotide ID:ENST00000449935Re-query CCDS DB by Protein ID:ENSP00000391403
Original member Current member EBI ENST00000438261.5 ENSP00000402194.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000438261.5Link to Ensembl Protein Viewer:ENSP00000402194.1Re-query CCDS DB by Nucleotide ID:ENST00000438261Re-query CCDS DB by Protein ID:ENSP00000402194
Original member Current member EBI ENST00000482975.6 ENSP00000441332.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000482975.6Link to Ensembl Protein Viewer:ENSP00000441332.1Re-query CCDS DB by Nucleotide ID:ENST00000482975Re-query CCDS DB by Protein ID:ENSP00000441332
Original member Current member NCBI NM_001317168.1 NP_001304097.1 Accepted alive Link to Nucleotide Sequence:NM_001317168.1Link to Protein Sequence:NP_001304097.1Re-query CCDS DB by Nucleotide ID:NM_001317168Re-query CCDS DB by Protein ID:NP_001304097Link to BLAST:NP_001304097.1
Original member Current member NCBI NM_001317169.2 NP_001304098.1 Accepted alive Link to Nucleotide Sequence:NM_001317169.2Link to Protein Sequence:NP_001304098.1Re-query CCDS DB by Nucleotide ID:NM_001317169Re-query CCDS DB by Protein ID:NP_001304098Link to BLAST:NP_001304098.1

Chromosomal Locations for CCDS 82461.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 70281634 70281684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 70288068 70288192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 70289350 70289368 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (195 nt):
ATGGACAAGAAGTTATCATTGAAATTAAATGGTGGCAGACATGTCCAAGGAATATTGCGGGGATTTGATC
CC
TTTATGAACCTTGTGATAGATGAATGTGTGGAGATGGCGACTAGTGGACAACAGAACAATATTGGAAT
G
GTGGTAATACGAGGAAATAGTATCATCATGTTAGAAGCCTTGGAACGAGTATAA


Translation (64 aa):
MDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

External link. Please review our privacy policy.
HHS Vulnerability Disclosure