NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS87647.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
87647.1 Public Homo sapiens 9 SMIM27 24 110 108 CCDS HistoryNCBI Gene:100129250Re-query CCDS DB by CCDS ID:87647.1Re-query CCDS DB by GeneID:100129250See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 22, NCBI annotation release 109, Ensembl annotation release 92

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 87647.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000453396.5 ENSP00000490275.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000453396.5Link to Ensembl Protein Viewer:ENSP00000490275.1Re-query CCDS DB by Nucleotide ID:ENST00000453396Re-query CCDS DB by Protein ID:ENSP00000490275
Original member Current member EBI ENST00000450093.3 ENSP00000490727.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000450093.3Link to Ensembl Protein Viewer:ENSP00000490727.2Re-query CCDS DB by Nucleotide ID:ENST00000450093Re-query CCDS DB by Protein ID:ENSP00000490727
Original member Current member EBI ENST00000692500.1 ENSP00000508648.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000692500.1Link to Ensembl Protein Viewer:ENSP00000508648.1Re-query CCDS DB by Nucleotide ID:ENST00000692500Re-query CCDS DB by Protein ID:ENSP00000508648
Original member Current member NCBI NM_001349118.1 NP_001336047.1 Accepted alive Link to Nucleotide Sequence:NM_001349118.1Link to Protein Sequence:NP_001336047.1Re-query CCDS DB by Nucleotide ID:NM_001349118Re-query CCDS DB by Protein ID:NP_001336047Link to BLAST:NP_001336047.1
Original member Current member NCBI NM_001349119.2 NP_001336048.1 Accepted alive Link to Nucleotide Sequence:NM_001349119.2Link to Protein Sequence:NP_001336048.1Re-query CCDS DB by Nucleotide ID:NM_001349119Re-query CCDS DB by Protein ID:NP_001336048Link to BLAST:NP_001336048.1
Original member Current member NCBI NM_001387564.1 NP_001374493.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001387564.1Link to Protein Sequence:NP_001374493.1Re-query CCDS DB by Nucleotide ID:NM_001387564Re-query CCDS DB by Protein ID:NP_001374493Link to BLAST:NP_001374493.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001336047.1 55 A0A1B0GUW7 55 100% 0 0
NP_001336048.1 55 A0A1B0GUW7 55 100% 0 0
NP_001374493.1 55 A0A1B0GUW7 55 100% 0 0

Chromosomal Locations for CCDS 87647.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 32552435 32552479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 32552801 32552923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (168 nt):
ATGAAGCCAGTAAGTCGTCGCACGCTGGACTGGATTTATTCAGTGTTGCTGCTTGCCATCGTTTTAATCT
CCTGGGGCTGCATCATCTATGCTTCGATGGTGTCTGCAAGACGACAGCTAAGGAAGAAATACCCAGACAA
AATCTTTGGGACGAATGAAAATTTGTAA

Translation (55 aa):
MKPVSRRTLDWIYSVLLLAIVLISWGCIIYASMVSARRQLRKKYPDKIFGTNENL


Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser

Disclaimer | Write to the Help Desk
NCBI | NLM | NIH