NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS9200.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
9200.1 Public Homo sapiens 12 DYNLL1 24 110 108 CCDS HistoryNCBI Gene:8655Re-query CCDS DB by CCDS ID:9200.1Re-query CCDS DB by GeneID:8655See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 9200.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000242577.11 ENSP00000242577.6 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000242577.11Link to Ensembl Protein Viewer:ENSP00000242577.6Re-query CCDS DB by Nucleotide ID:ENST00000242577Re-query CCDS DB by Protein ID:ENSP00000242577
Original member Current member EBI ENST00000392508.2 ENSP00000376296.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392508.2Link to Ensembl Protein Viewer:ENSP00000376296.2Re-query CCDS DB by Nucleotide ID:ENST00000392508Re-query CCDS DB by Protein ID:ENSP00000376296
Original member Current member EBI ENST00000392509.6 ENSP00000376297.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392509.6Link to Ensembl Protein Viewer:ENSP00000376297.2Re-query CCDS DB by Nucleotide ID:ENST00000392509Re-query CCDS DB by Protein ID:ENSP00000376297
Original member Current member EBI ENST00000549989.1 ENSP00000446614.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000549989.1Link to Ensembl Protein Viewer:ENSP00000446614.1Re-query CCDS DB by Nucleotide ID:ENST00000549989Re-query CCDS DB by Protein ID:ENSP00000446614
Original member Current member EBI ENST00000548342.5 ENSP00000447907.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000548342.5Link to Ensembl Protein Viewer:ENSP00000447907.1Re-query CCDS DB by Nucleotide ID:ENST00000548342Re-query CCDS DB by Protein ID:ENSP00000447907
Original member Current member NCBI NM_001037494.2 NP_001032583.1 Accepted alive Link to Nucleotide Sequence:NM_001037494.2Link to Protein Sequence:NP_001032583.1Re-query CCDS DB by Nucleotide ID:NM_001037494Re-query CCDS DB by Protein ID:NP_001032583Link to BLAST:NP_001032583.1
Original member Current member NCBI NM_001037495.2 NP_001032584.1 Accepted alive Link to Nucleotide Sequence:NM_001037495.2Link to Protein Sequence:NP_001032584.1Re-query CCDS DB by Nucleotide ID:NM_001037495Re-query CCDS DB by Protein ID:NP_001032584Link to BLAST:NP_001032584.1
Original member Current member NCBI NM_003746.3 NP_003737.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_003746.3Link to Protein Sequence:NP_003737.1Re-query CCDS DB by Nucleotide ID:NM_003746Re-query CCDS DB by Protein ID:NP_003737Link to BLAST:NP_003737.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001032583.1 89 P63167 89 100% 0 0
NP_001032584.1 89 P63167 89 100% 0 0
NP_003737.1 89 P63167 89 100% 0 0

Chromosomal Locations for CCDS 9200.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 120496422 120496553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 120498073 120498210 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (270 nt):
ATGTGCGACCGAAAGGCCGTGATCAAAAATGCGGACATGTCGGAAGAGATGCAACAGGACTCGGTGGAGT
GC
GCTACTCAGGCGCTGGAGAAATACAACATAGAGAAGGACATTGCGGCTCATATCAAGAAGGAATTTGA
C
AAGAAGTACAATCCCACCTGGCATTGCATCGTGGGGAGGAACTTCGGTAGTTATGTGACACATGAAACC
AAA
CACTTCATCTACTTCTACCTGGGCCAAGTGGCCATTCTTCTGTTCAAATCTGGTTAA


Translation (89 aa):
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET
K
HFIYFYLGQVAILLFKSG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser