NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS13636.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
13636.1 Public Homo sapiens 21 KCNE1 24 110 108 CCDS HistoryNCBI Gene:3753Re-query CCDS DB by CCDS ID:13636.1See the combined annotation on chromosome 21 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 13636.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000337385.7 ENSP00000337255.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000337385.7Link to Ensembl Protein Viewer:ENSP00000337255.3Re-query CCDS DB by Nucleotide ID:ENST00000337385Re-query CCDS DB by Protein ID:ENSP00000337255
Original member Current member EBI ENST00000399284.1 ENSP00000382225.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000399284.1Link to Ensembl Protein Viewer:ENSP00000382225.1Re-query CCDS DB by Nucleotide ID:ENST00000399284Re-query CCDS DB by Protein ID:ENSP00000382225
Original member Current member EBI ENST00000399286.3 ENSP00000382226.2 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000399286.3Link to Ensembl Protein Viewer:ENSP00000382226.2Re-query CCDS DB by Nucleotide ID:ENST00000399286Re-query CCDS DB by Protein ID:ENSP00000382226
Original member Current member EBI ENST00000399289.7 ENSP00000382228.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000399289.7Link to Ensembl Protein Viewer:ENSP00000382228.3Re-query CCDS DB by Nucleotide ID:ENST00000399289Re-query CCDS DB by Protein ID:ENSP00000382228
Original member Current member EBI ENST00000432085.5 ENSP00000412498.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000432085.5Link to Ensembl Protein Viewer:ENSP00000412498.1Re-query CCDS DB by Nucleotide ID:ENST00000432085Re-query CCDS DB by Protein ID:ENSP00000412498
Original member Current member EBI ENST00000416357.6 ENSP00000416258.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000416357.6Link to Ensembl Protein Viewer:ENSP00000416258.2Re-query CCDS DB by Nucleotide ID:ENST00000416357Re-query CCDS DB by Protein ID:ENSP00000416258
Original member Current member EBI ENST00000611936.1 ENSP00000478215.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000611936.1Link to Ensembl Protein Viewer:ENSP00000478215.1Re-query CCDS DB by Nucleotide ID:ENST00000611936Re-query CCDS DB by Protein ID:ENSP00000478215
Original member Current member EBI ENST00000621601.4 ENSP00000483895.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000621601.4Link to Ensembl Protein Viewer:ENSP00000483895.1Re-query CCDS DB by Nucleotide ID:ENST00000621601Re-query CCDS DB by Protein ID:ENSP00000483895
Original member Current member NCBI NM_000219.6 NP_000210.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_000219.6Link to Protein Sequence:NP_000210.2Re-query CCDS DB by Nucleotide ID:NM_000219Re-query CCDS DB by Protein ID:NP_000210Link to BLAST:NP_000210.2
Original member Current member NCBI NM_001127668.4 NP_001121140.1 Accepted alive Link to Nucleotide Sequence:NM_001127668.4Link to Protein Sequence:NP_001121140.1Re-query CCDS DB by Nucleotide ID:NM_001127668Re-query CCDS DB by Protein ID:NP_001121140Link to BLAST:NP_001121140.1
Original member Current member NCBI NM_001127669.4 NP_001121141.1 Accepted alive Link to Nucleotide Sequence:NM_001127669.4Link to Protein Sequence:NP_001121141.1Re-query CCDS DB by Nucleotide ID:NM_001127669Re-query CCDS DB by Protein ID:NP_001121141Link to BLAST:NP_001121141.1
Original member Current member NCBI NM_001127670.4 NP_001121142.1 Accepted alive Link to Nucleotide Sequence:NM_001127670.4Link to Protein Sequence:NP_001121142.1Re-query CCDS DB by Nucleotide ID:NM_001127670Re-query CCDS DB by Protein ID:NP_001121142Link to BLAST:NP_001121142.1
Original member Current member NCBI NM_001270402.3 NP_001257331.1 Accepted alive Link to Nucleotide Sequence:NM_001270402.3Link to Protein Sequence:NP_001257331.1Re-query CCDS DB by Nucleotide ID:NM_001270402Re-query CCDS DB by Protein ID:NP_001257331Link to BLAST:NP_001257331.1
Original member Current member NCBI NM_001270403.2 NP_001257332.1 Accepted alive Link to Nucleotide Sequence:NM_001270403.2Link to Protein Sequence:NP_001257332.1Re-query CCDS DB by Nucleotide ID:NM_001270403Re-query CCDS DB by Protein ID:NP_001257332Link to BLAST:NP_001257332.1
Original member Current member NCBI NM_001270404.3 NP_001257333.1 Accepted alive Link to Nucleotide Sequence:NM_001270404.3Link to Protein Sequence:NP_001257333.1Re-query CCDS DB by Nucleotide ID:NM_001270404Re-query CCDS DB by Protein ID:NP_001257333Link to BLAST:NP_001257333.1
Original member Current member NCBI NM_001270405.3 NP_001257334.1 Accepted alive Link to Nucleotide Sequence:NM_001270405.3Link to Protein Sequence:NP_001257334.1Re-query CCDS DB by Nucleotide ID:NM_001270405Re-query CCDS DB by Protein ID:NP_001257334Link to BLAST:NP_001257334.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000210.2 129 P15382 129 100% 0 0
NP_001121140.1 129 P15382 129 100% 0 0
NP_001121141.1 129 P15382 129 100% 0 0
NP_001121142.1 129 P15382 129 100% 0 0
NP_001257331.1 129 P15382 129 100% 0 0
NP_001257332.1 129 P15382 129 100% 0 0
NP_001257333.1 129 P15382 129 100% 0 0
NP_001257334.1 129 P15382 129 100% 0 0

Chromosomal Locations for CCDS 13636.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 21 (NC_000021.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21See the combined annotation on chromosome 21 in Sequence Viewer

Chromosome Start Stop Links
21 34449245 34449634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 21Link to Ensembl Genome Browser on chromosome 21

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (390 nt):
ATGATCCTGTCTAACACCACAGCGGTGACGCCCTTTCTGACCAAGCTGTGGCAGGAGACAGTTCAGCAGG
GT
GGCAACATGTCGGGCCTGGCCCGCAGGTCCCCCCGCAGCAGTGACGGCAAGCTGGAGGCCCTCTACGT
C
CTCATGGTACTGGGATTCTTCGGCTTCTTCACCCTGGGCATCATGCTGAGCTACATCCGCTCCAAGAAG
CTG
GAGCACTCGAACGACCCATTCAACGTCTACATCGAGTCCGATGCCTGGCAAGAGAAGGACAAGGCCT
AT
GTCCAGGCCCGGGTCCTGGAGAGCTACAGGTCGTGCTATGTCGTTGAAAACCATCTGGCCATAGAACA
A
CCCAACACACACCTTCCTGAGACGAAGCCTTCCCCATGA


Translation (129 aa):
MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKK
L
EHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser