1W1N


Conserved Protein Domain Family
FATC

?
pfam02260: FATC (this model, PSSM-Id:280430 is obsolete and has been replaced by 460514)
Click on image for an interactive view with Cn3D
FATC domain
The FATC domain is named after FRAP, ATM, TRRAP C-terminal. The solution structure of the FATC domain suggests it plays a role in redox-dependent structural and cellular stability.
Statistics
?
PSSM-Id: 280430
Aligned: 365 rows
Threshold Bit Score: 36.9755
Created: 9-Jul-2015
Updated: 5-Aug-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W1N_A          3 LDVPEQVDKLIQQATSIERLCQHYIGWCPFW 33   baker's yeast
Q9HFE8       3669 LPVNQTAIDYLAQASSSKVLAQMDVLWAPWL 3699 Schizosaccharomyces pombe 972h-
Q0UBC8       3767 LPANQTVVDLVAVAVDPKKLASMDPLWMGYL 3797 Phaeosphaeria nodorum SN15
XP_009154932 3770 LPACQNVVDLVSRATDPMKLSAMDGLWMPWL 3800 Exophiala dermatitidis NIH/UT8656
EMF11987     2166 LPASQSVLDLVARATNPEKLAQTDLLWMPWL 2196 Sphaerulina musiva SO2202
XP_001242569 3746 LPANQSAIDLISKAVNPQSLAQCEALWMPYM 3776 Coccidioides immitis RS
CCF41112     1053 LPANQTVIDLVAKAVNPMNLAQCDALWMPYL 1083 Colletotrichum higginsianum
EPE05023     4003 LPAYQTVIDLIAKATNPVNLAMCDVLWMAFL 4033 Ophiostoma piceae UAMH 11346
XP_008087754 3821 LPANQTVIDLIARAVNPMNLAQMEPLFMAYL 3851 Glarea lozoyensis ATCC 20868
XP_002175701 3607 LPANQTILDYISQAVNPKALAQMDVLWAPWL 3637 Schizosaccharomyces japonicus yFS275
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap