Conserved Protein Domain Family
PP1

?
pfam07430: PP1 
Phloem filament protein PP1 cystatin-like domain
This domain represents a conserved region related to cystatins. Eight copies of which are found within the plant phloem filament protein PP1. This is one of the constituents of the proteinaceous filaments found in the sieve elements of Cucurbita phloem.
Statistics
?
PSSM-Id: 311397
Aligned: 6 rows
Threshold Bit Score: 103.675
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P94012 725 AFLQEVSKFALDDFNvKSGDSLRFDGIYDGWYMEMGQDNIKFRIHLRAKDCLSRVHHYEAYVYVKQFLSKRIKIVESF 802 winter squash
P94012 133 PFVQEVSKFAIDEYN-KGGEGLKYVEIYDGWYAEMGQDNIKFRLHVKAKDCLGRLRNYEAIVLVKQFLSKKIKILESF 209 winter squash
P94012 329 PLVQELAKFAVDEHN-KNGDGLKYIEVYEGWFMDLGHDNIKFRLHLKAKDWLGRIRNYEAVVLVEHFWSKRIKILESF 405 winter squash
P94012  26 HCVQEVAKLAVEQFNvQHGHSLKYDSIHEGWYCELGQNNLKYRLHIRAIDFLQRSLLYEALVFEEKPKLERIRKLISF 103 winter squash
P94012 230 LGLQVVIKFIVEQIKiKFGDSLKFEIVYEGWYFELCPNSLKYRFHVKVIDFLGRSLKFEIIIIEERRVLLRIWKLDSI 307 winter squash
P94012 622 PGFQVVINFIVEQLKiILGDCLKFHSIYEGWYFELCPISLKFRLHIKAIDFLGRCLNYEIIIIEEK----RIFKLESI 695 winter squash
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap