6S8F


Conserved Protein Domain Family
FATC
?
pfam02260: FATC (this model, PSSM-Id:396715 is obsolete and has been replaced by 460514)
Click on image for an interactive view with Cn3D
FATC domain
The FATC domain is named after FRAP, ATM, TRRAP C-terminal. The solution structure of the FATC domain suggests it plays a role in redox-dependent structural and cellular stability.
Links
?
Statistics
?
PSSM-Id: 396715
Aligned: 305 rows
Threshold Bit Score: 36.5869
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Download Cn3D
PubMed ReferencesClick to see Conserved Features Help
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection: 
6S8F_H              2757 GLSVESSVQDLIQQATDPSNLSVIYMGWSPFY 2788 baker's yeast
XP_008093883        3821 NLPANQTVIDLIAKAVNPMNLAQCDALWMPYL 3852 Colletotrichum graminicola M1.001
EFW22703            3713 NLPANQSAIDLISKAVNPQSLAQCEALWMPYM 3744 Coccidioides posadasii str. Silveira
EPE24839            3820 ALPANQTVIDLIARAVNPMNLAQMEPLFMAYL 3851 Glarea lozoyensis ATCC 20868
Q0UBC8              3766 NLPANQTVVDLVAVAVDPKKLASMDPLWMGYL 3797 Parastagonospora nodorum SN15
EMF11987            2165 NLPASQSVLDLVARATNPEKLAQTDLLWMPWL 2196 Sphaerulina musiva SO2202
EHY54471            3769 vLPACQNVVDLVSRATDPMKLSAMDGLWMPWL 3800 Exophiala dermatitidis NIH/UT8656
WGS:AATM:SJAG_04613 3606 NLPANQTILDYISQAVNPKALAQMDVLWAPWL 3637 Schizosaccharomyces japonicus yFS275
Q9HFE8              3668 NLPVNQTAIDYLAQASSSKVLAQMDVLWAPWL 3699 Schizosaccharomyces pombe 972h-
Q6CDB3              3778 nVPANQTVIDLISQAVNPRYLALTDNLWQAYL 3809 Yarrowia lipolytica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap