NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|209978900|gb|ACJ04724|]
View 

FSHR, partial [Homo sapiens]

Protein Classification

G protein-coupled receptor family protein( domain architecture ID 705710)

G protein-coupled receptor family protein is a seven-transmembrane G protein-coupled receptor (7TM-GPCR) family protein which typically transmits an extracellular signal into the cell by the conformational rearrangement of the 7TM helices and by the subsequent binding and activation of an intracellular heterotrimeric G protein; GPCR ligands include light-sensitive compounds, odors, pheromones, hormones, and neurotransmitters

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
1-72 2.49e-34

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15360:

Pssm-ID: 475119  Cd Length: 275  Bit Score: 117.27  E-value: 2.49e-34
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVPLITVSKA 72
Cdd:cd15360  174 VLNVLAFLIICACYIKIYLTVRNPNFVSSNSDTKIAKRMAVLIFTDFLCMAPISFFAISASLKVPLITVSKS 245
 
Name Accession Description Interval E-value
7tmA_FSH-R cd15360
follicle-stimulating hormone receptor, member of the class A family of seven-transmembrane G ...
1-72 2.49e-34

follicle-stimulating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The glycoprotein hormone receptors are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone family includes the three gonadotropins: luteinizing hormone (LH), follicle-stimulating hormone (FSH), chorionic gonadotropin (CG), and a pituitary thyroid-stimulating hormone (TSH). The glycoprotein hormones exert their biological functions by interacting with their cognate GPCRs. Both LH and CG bind to the same receptor, the luteinizing hormone-choriogonadotropin receptor (LHCGR); FSH binds to FSH-R and TSH to TSH-R. FSH-R functions in gonad development and is found in the ovary, testis, and uterus. Defects in this receptor cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. The FSH-R activation couples to the G(s)-protein and stimulates adenylate cyclase, thereby promoting cAMP production.


Pssm-ID: 320482  Cd Length: 275  Bit Score: 117.27  E-value: 2.49e-34
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVPLITVSKA 72
Cdd:cd15360  174 VLNVLAFLIICACYIKIYLTVRNPNFVSSNSDTKIAKRMAVLIFTDFLCMAPISFFAISASLKVPLITVSKS 245
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
4-63 1.92e-03

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 34.58  E-value: 1.92e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 209978900    4 VLAFVVICGCYIHIYLTVRNPNIVSSSS-----DTRIAKRMVMLIFTDFLCMAPISFFAISASLK 63
Cdd:pfam00001 161 LLPLLVILVCYTLIIRTLRKSASKQKSSertqrRRKALKTLAVVVVVFILCWLPYHIVNLLDSLA 225
 
Name Accession Description Interval E-value
7tmA_FSH-R cd15360
follicle-stimulating hormone receptor, member of the class A family of seven-transmembrane G ...
1-72 2.49e-34

follicle-stimulating hormone receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The glycoprotein hormone receptors are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone family includes the three gonadotropins: luteinizing hormone (LH), follicle-stimulating hormone (FSH), chorionic gonadotropin (CG), and a pituitary thyroid-stimulating hormone (TSH). The glycoprotein hormones exert their biological functions by interacting with their cognate GPCRs. Both LH and CG bind to the same receptor, the luteinizing hormone-choriogonadotropin receptor (LHCGR); FSH binds to FSH-R and TSH to TSH-R. FSH-R functions in gonad development and is found in the ovary, testis, and uterus. Defects in this receptor cause ovarian dysgenesis type 1, and also ovarian hyperstimulation syndrome. The FSH-R activation couples to the G(s)-protein and stimulates adenylate cyclase, thereby promoting cAMP production.


Pssm-ID: 320482  Cd Length: 275  Bit Score: 117.27  E-value: 2.49e-34
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVPLITVSKA 72
Cdd:cd15360  174 VLNVLAFLIICACYIKIYLTVRNPNFVSSNSDTKIAKRMAVLIFTDFLCMAPISFFAISASLKVPLITVSKS 245
7tmA_Glyco_hormone_R cd15136
glycoprotein hormone receptors, member of the class A family of seven-transmembrane G ...
1-72 9.18e-30

glycoprotein hormone receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The glycoprotein hormone receptors (GPHRs) are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone family includes three gonadotropins: luteinizing hormone (LH), follicle-stimulating hormone (FSH), chorionic gonadotropin (CG) and a pituitary thyroid-stimulating hormone (TSH). The glycoprotein hormones exert their biological functions by interacting with their cognate GPCRs. Both LH and CG bind to the same receptor, the luteinizing hormone-choriogonadotropin receptor (LHCGR); FSH binds to FSH-R and TSH to TSH-R. GPHRs couple primarily to the G(s)-protein and promotes cAMP production, but also to the G(i)- or G(q)-protein.


Pssm-ID: 320264 [Multi-domain]  Cd Length: 275  Bit Score: 105.37  E-value: 9.18e-30
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVPLITVSKA 72
Cdd:cd15136  174 LFNGLAFLIICGCYIKIYLSVRGSGRAANSNDTRIAKRMALLVFTDFLCWAPIAFFGLTAAFGLPLISVSNA 245
7tmA_LHCGR cd15359
luteinizing hormone-choriogonadotropin receptor, member of the class A family of ...
1-72 5.63e-28

luteinizing hormone-choriogonadotropin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The glycoprotein hormone receptors are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone family includes the three gonadotropins: luteinizing hormone (LH), follicle-stimulating hormone (FSH), chorionic gonadotropin (CG), and a pituitary thyroid-stimulating hormone (TSH). The glycoprotein hormones exert their biological functions by interacting with their cognate GPCRs. Both LH and CG bind to the same receptor, the luteinizing hormone-choriogonadotropin receptor (LHCGR); FSH binds to FSH-R and TSH to TSH-R. LHCGR is expressed predominantly in the ovary and testis, and plays an essential role in sexual development and reproductive processes. LHCGR couples primarily to the G(s)-protein and activates adenylate cyclase, thereby promoting cAMP production.


Pssm-ID: 320481 [Multi-domain]  Cd Length: 275  Bit Score: 101.09  E-value: 5.63e-28
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVPLITVSKA 72
Cdd:cd15359  174 VLNVIAFLVICACYIKIYLAVQNPELVAKNKDTKIAKRMAILIFTDFTCMAPISFFAISAAFKVPLITVTNS 245
7tmA_TSH-R cd15964
thyroid-stimulating hormone receptor (or thyrotropin receptor), member of the class A family ...
1-72 1.15e-26

thyroid-stimulating hormone receptor (or thyrotropin receptor), member of the class A family of seven-transmembrane G protein-coupled receptors; The glycoprotein hormone receptors are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone family includes the three gonadotropins: luteinizing hormone (LH), follicle-stimulating hormone (FSH), chorionic gonadotropin (CG), and a pituitary thyroid-stimulating hormone (TSH). The glycoprotein hormones exert their biological functions by interacting with their cognate GPCRs. Both LH and CG bind to the same receptor, the luteinizing hormone-choriogonadotropin receptor (LHCGR); FSH binds to FSH-R and TSH to TSH-R. TSH-R plays an important role thyroid physiology, and its activation stimulates the production of thyroxine (T4) and triiodothyronine (T3). Defects in TSH-R are a cause of several types of hyperthyroidism. The receptor is predominantly found on the surface of the thyroid epithelial cells and couples to the G(s)-protein and activates adenylate cyclase, thereby promoting cAMP production. TSH and cAMP stimulate thyroid cell proliferation, differentiation, and function.


Pssm-ID: 320630 [Multi-domain]  Cd Length: 275  Bit Score: 97.67  E-value: 1.15e-26
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVRNPNIVSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVPLITVSKA 72
Cdd:cd15964  174 MLNIIAFVIICACYIKIYITVRNPQYKSGDKDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNS 245
7tmA_Glycoprotein_LRR_R-like cd14980
glycoprotein hormone receptors and leucine-rich repeats containing G protein-coupled receptors, ...
1-69 1.41e-10

glycoprotein hormone receptors and leucine-rich repeats containing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes the glycoprotein hormone receptors (GPHRs), vertebrate receptors containing 17 leucine-rich repeats (LGR4-6), and the relaxin family peptide receptors (also known as LGR7 and LGR8). They are seven transmembrane domain receptors with a very large extracellular N-terminal domain containing many leucine-rich repeats responsible for hormone recognition and binding. The glycoprotein hormone receptor family contains receptors for the pituitary hormones, thyrotropin (thyroid-stimulating hormone receptor), follitropin (follicle-stimulating hormone receptor), and lutropin (luteinizing hormone receptor). Glycoprotein hormone receptors couple primarily to the G(s)-protein and promotes cAMP production, but also to the G(i)- or G(q)-protein. Two orphan GPCRs, LGR7 and LGR8, have been recently identified as receptors for the relaxin peptide hormones.


Pssm-ID: 320111 [Multi-domain]  Cd Length: 286  Bit Score: 54.55  E-value: 1.41e-10
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVRNPNI----VSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVPLITV 69
Cdd:cd14980  181 LLTFIAWIIICILYILIFISVRKSRKsarrSSSKRDKRIAIRLALILITDLICWLPYYIVIFSGLLTSTEIDI 253
7tmA_Relaxin_R cd15137
relaxin family peptide receptors, member of the class A family of seven-transmembrane G ...
1-65 2.95e-09

relaxin family peptide receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes relaxin/insulin-like family peptide receptor 1 (RXFP1 or LGR7) and 2 (RXFP2 or LGR8), which contain a very large extracellular N-terminal domain with numerous leucine-rich repeats responsible for hormone recognition and binding. Relaxin is a member of the insulin superfamily that has diverse actions in both reproductive and non-reproductive tissues. The relaxin-like peptide family includes relaxin-1, relaxin-2, and the insulin-like (INSL) peptides such as INSL3, INSL4, INSL5 and INSL6. The relaxin family peptides share high structural but low sequence similarity, and exert their physiological functions by activating a group of four GPCRs, RXFP1-4. Relaxin and INSL3 are the endogenous ligands for RXFP1 and RXFP2, respectively. Upon receptor binding, relaxin activates a variety of signaling pathways to produce second messengers such as cAMP.


Pssm-ID: 320265 [Multi-domain]  Cd Length: 284  Bit Score: 51.05  E-value: 2.95e-09
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 209978900   1 VLNVLAFVVICGCYIHIYLTVR----NPNIVSSSSDTRIAKRMVMLIFTDFLCMAPISFFAISASLKVP 65
Cdd:cd15137  180 GLNFLAFVFILLSYIAMFISIRrtrkAAASRKSKRDMAVAKRFFLIVLTDFLCWIPIIVIGILALSGVP 248
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
4-63 1.92e-03

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 34.58  E-value: 1.92e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 209978900    4 VLAFVVICGCYIHIYLTVRNPNIVSSSS-----DTRIAKRMVMLIFTDFLCMAPISFFAISASLK 63
Cdd:pfam00001 161 LLPLLVILVCYTLIIRTLRKSASKQKSSertqrRRKALKTLAVVVVVFILCWLPYHIVNLLDSLA 225
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH