NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1187838714|gb|ARM55789|]
View 

olfactory receptor family 8, partial [Desmodus rotundus]

Protein Classification

G protein-coupled receptor family protein( domain architecture ID 705710)

G protein-coupled receptor family protein is a seven-transmembrane G protein-coupled receptor (7TM-GPCR) family protein which typically transmits an extracellular signal into the cell by the conformational rearrangement of the 7TM helices and by the subsequent binding and activation of an intracellular heterotrimeric G protein; GPCR ligands include light-sensitive compounds, odors, pheromones, hormones, and neurotransmitters

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
1-104 4.95e-50

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15406:

Pssm-ID: 475119 [Multi-domain]  Cd Length: 290  Bit Score: 159.46  E-value: 4.95e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15406    73 EKNIISYPECMTQLFFFCVFAIAECYMLTAMAYDRYVAICNPLLYNVTMSPRVCSLLVAGVYIMGLIGATVHTSCMLRLS 152
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15406   153 FCGDnVINHYFCDILPLLKLSCSST 177
 
Name Accession Description Interval E-value
7tmA_OR8D-like cd15406
olfactory receptor subfamily 8D and related proteins, member of the class A family of ...
1-104 4.95e-50

olfactory receptor subfamily 8D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8D and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320528 [Multi-domain]  Cd Length: 290  Bit Score: 159.46  E-value: 4.95e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15406    73 EKNIISYPECMTQLFFFCVFAIAECYMLTAMAYDRYVAICNPLLYNVTMSPRVCSLLVAGVYIMGLIGATVHTSCMLRLS 152
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15406   153 FCGDnVINHYFCDILPLLKLSCSST 177
7tm_4 pfam13853
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
5-103 1.61e-09

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


Pssm-ID: 404695  Cd Length: 278  Bit Score: 52.89  E-value: 1.61e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:pfam13853  62 ISFEACLTQMFFIHKFSIMESAVLLAMAVDRFVAICSPLRYTTILTNPVISRIGLGVSVRSFILVLPLPFLLRRLPFCgH 141
                          90       100
                  ....*....|....*....|
gi 1187838714  84 VLITHYFCDILPLMKLSCSS 103
Cdd:pfam13853 142 HVLSHSYCLHMGLARLSCAD 161
 
Name Accession Description Interval E-value
7tmA_OR8D-like cd15406
olfactory receptor subfamily 8D and related proteins, member of the class A family of ...
1-104 4.95e-50

olfactory receptor subfamily 8D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8D and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320528 [Multi-domain]  Cd Length: 290  Bit Score: 159.46  E-value: 4.95e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15406    73 EKNIISYPECMTQLFFFCVFAIAECYMLTAMAYDRYVAICNPLLYNVTMSPRVCSLLVAGVYIMGLIGATVHTSCMLRLS 152
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15406   153 FCGDnVINHYFCDILPLLKLSCSST 177
7tmA_OR5-like cd15230
olfactory receptor family 5 and related proteins, member of the class A family of ...
2-104 4.95e-42

olfactory receptor family 5 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 5, some subfamilies from families 8 and 9, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320358  Cd Length: 270  Bit Score: 138.41  E-value: 4.95e-42
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15230    65 KKTISFAGCAAQFFFFAVFGTTECFLLAAMAYDRYVAICNPLLYTVIMSKRVCIQLVAGSYLCGFVNSIVHTSSTFSLSF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15230   145 CGSnVINHFFCDIPPLLKLSCSDT 168
7tmA_OR8B-like cd15405
olfactory receptor subfamily 8B and related proteins, member of the class A family of ...
1-104 2.90e-40

olfactory receptor subfamily 8B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320527 [Multi-domain]  Cd Length: 277  Bit Score: 134.08  E-value: 2.90e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15405    64 EKNTISYAGCMTQLFFFCFFVISECYVLTAMAYDRYVAICNPLLYTVTMSPQVCSLLMLGSYVMGFAGAMAHTGCMLRLT 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15405   144 FCDSnIINHYMCDILPLLQLSCTST 168
7tmA_OR cd13954
olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled ...
1-104 4.70e-40

olfactory receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320092 [Multi-domain]  Cd Length: 270  Bit Score: 133.38  E-value: 4.70e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd13954    64 GDKTISFSGCLTQLYFFFSLGGTECFLLAVMAYDRYVAICHPLHYPTIMNKRVCILLAAGSWLIGFLNSLIHTVLISQLP 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCE-VLITHYFCDILPLMKLSCSST 104
Cdd:cd13954   144 FCGsNVINHFFCDIPPLLKLSCSDT 168
7tmA_OR5AK3-like cd15408
olfactory receptor subfamily 5AK3, 5AU1, and related proteins, member of the class A family of ...
2-104 2.42e-37

olfactory receptor subfamily 5AK3, 5AU1, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AK3, 5AU1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320530  Cd Length: 287  Bit Score: 127.05  E-value: 2.42e-37
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15408    78 RKVISFTGCLTQLYFYAVFATTECYLLAAMAYDRYVAICNPLLYTVIMSQRVCVSLVAGSYLAGFLNSTVHTGFILRLSF 157
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15408   158 CGSnVINHFFCDGPPLLALSCSDT 181
7tmA_OR13-like cd15232
olfactory receptor family 13 and related proteins, member of the class A family of ...
2-104 1.89e-36

olfactory receptor family 13 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 13 (subfamilies 13A1 and 13G1) and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320360 [Multi-domain]  Cd Length: 270  Bit Score: 124.29  E-value: 1.89e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15232    65 RKTISFGGCMAQLYFFTWSLGSELLLLTAMAYDRYVAICHPLHYSTIMRKEVCVGLATGVWAIGMLNSAVHTGLMLRLSF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15232   145 CGPnIINHFFCEIPPLLLLSCSDT 168
7tmA_OR1_7-like cd15918
olfactory receptor families 1, 7, and related proteins, member of the class A family of ...
5-104 2.52e-36

olfactory receptor families 1, 7, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 1 and 7, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320584 [Multi-domain]  Cd Length: 270  Bit Score: 123.88  E-value: 2.52e-36
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15918    68 ISYAGCLTQMYFFLLFGDLDNFLLAVMAYDRYVAICHPLHYTTIMSPRLCILLVAASWVITNLHSLLHTLLMARLSFCaS 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15918   148 NEIPHFFCDLNPLLKLSCSDT 168
7tmA_OR1A-like cd15235
olfactory receptor subfamily 1A and related proteins, member of the class A family of ...
1-104 2.47e-35

olfactory receptor subfamily 1A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 1A, 1B, 1K, 1L, 1Q and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320363 [Multi-domain]  Cd Length: 278  Bit Score: 121.56  E-value: 2.47e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15235    65 GSKTISYAGCLAQMYFFIAFGNTDSFLLAVMAYDRYVAICHPLHYATVMSPKRCLLLVAGSWLLSHLHSLLHTLLMSRLS 144
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YC-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15235   145 FCgSNEIPHFFCDLQPLLKLSCSDT 169
7tmA_OR11A-like cd15911
olfactory receptor subfamily 11A and related proteins, member of the class A family of ...
5-104 4.42e-35

olfactory receptor subfamily 11A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11A and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320577  Cd Length: 270  Bit Score: 120.67  E-value: 4.42e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15911    68 ISVSGCIVQFYFFGSLAATECYLLAVMSYDRYLAICKPLHYASLMNGRLCLQLAAGSWISGFLASTITVILMSQLTFCGP 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15911   148 nEIDHFFCDFAPLLKLSCSDT 168
7tmA_OR10A-like cd15225
olfactory receptor subfamily 10A and related proteins, member of the class A family of ...
5-104 6.48e-35

olfactory receptor subfamily 10A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10A, 10C, 10H, 10J, 10V, 10R, 10J, 10W, among others, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320353  Cd Length: 277  Bit Score: 120.25  E-value: 6.48e-35
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15225    68 ISFLGCATQMFFFLFLGGTECFLLAAMAYDRYVAICNPLRYTLIMNRRVCLQLVAGSWLSGILVSLGQTTLIFSLPFCGS 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15225   148 nEINHFFCDIPPVLKLACADT 168
7tmA_OR5AP2-like cd15943
olfactory receptor subfamily 5AP2 and related proteins, member of the class A family of ...
2-104 1.26e-34

olfactory receptor subfamily 5AP2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AP2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320609 [Multi-domain]  Cd Length: 295  Bit Score: 120.16  E-value: 1.26e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15943    79 NKTISFTGCAAQMYFFVAFATTECFLLAVMAYDRYVAICNPLLYTVIMSPRVCIQLVAGSYLIGFVNALIQTICTFRLPF 158
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15943   159 CGSnVINHFFCDVPPLLKLSCSDT 182
7tmA_OR5D-like cd15410
olfactory receptor subfamily 5D and related proteins, member of the class A family of ...
5-104 3.34e-34

olfactory receptor subfamily 5D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5D, 5L, 5W, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320532  Cd Length: 294  Bit Score: 118.92  E-value: 3.34e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15410    81 ISYSGCMLQFFFFCTFVVTESFLLAVMAYDRYVAICNPLLYTVIMSRKLCVLLVAGSYLWGIVCSLIHTCGLLRLSFCGS 160
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15410   161 nVINHFFCDLPPLLSLSCSDT 181
7tmA_OR14-like cd15227
olfactory receptor family 14 and related proteins, member of the class A family of ...
3-104 5.71e-34

olfactory receptor family 14 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 14 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320355  Cd Length: 270  Bit Score: 117.55  E-value: 5.71e-34
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   3 NIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC 82
Cdd:cd15227    66 RSISFLGCVAQVFLFIFFAASELALLTVMAYDRYVAICHPLHYEVIMNRGACVQMAAASWLSGLLYGALHTANTFSLPFC 145
                          90       100
                  ....*....|....*....|...
gi 1187838714  83 EV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15227   146 GSnVIHQFFCDIPQLLKLSCSDT 168
7tmA_OR9K2-like cd15419
olfactory receptor subfamily 9K2 and related proteins, member of the class A family of ...
2-104 6.22e-33

olfactory receptor subfamily 9K2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes transmembrane olfactory receptor subfamily 9K2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320541  Cd Length: 279  Bit Score: 115.10  E-value: 6.22e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15419    65 SKTISYNGCAAQFFFFSLFGTTEGFLLAAMAYDRFIAICNPLLYPVIMSRRVCVQLVAGSYLCGCINSIIQTSFTFSLSF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15419   145 CgSNEIDHFFCDVPPLLKLSCSDT 168
7tmA_OR8H-like cd15411
olfactory receptor subfamily 8H and related proteins, member of the class A family of ...
2-104 7.33e-33

olfactory receptor subfamily 8H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8H, 8I, 5F and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320533 [Multi-domain]  Cd Length: 279  Bit Score: 115.11  E-value: 7.33e-33
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15411    65 RKAISFAGCFVQMYFFIALATTECFLLGLMAYDRYVAICNPLLYTVVMSRRVCLKLAAGSYAAGFLNSLIHTTLISRLSF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15411   145 CGSnVINHFFCDTPPLLKLSCSDT 168
7tmA_OR5V1-like cd15231
olfactory receptor subfamily 5V1 and related proteins, member of the class A family of ...
1-104 1.89e-32

olfactory receptor subfamily 5V1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5V1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320359 [Multi-domain]  Cd Length: 277  Bit Score: 113.90  E-value: 1.89e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15231    64 ERKTISYIGCLAQLFFFVSFVGTECLLLAVMAYDRYVAICNPLHYAVIMSRKVCLQLAAASWLCGFLNSAVHTVLTFRLS 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15231   144 FCGSnQISHFFCDIPPLLKLSCSDT 168
7tmA_OR6C-like cd15912
olfactory receptor subfamily 6C and related proteins, member of the class A family of ...
2-104 6.82e-32

olfactory receptor subfamily 6C and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6C, 6X, 6J, 6T, 6V, 6M, 9A, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320578  Cd Length: 270  Bit Score: 112.19  E-value: 6.82e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15912    65 KKTISFAGCFAQSFFYFFLGTTEFFLLAVMSFDRYVAICNPLHYPTIMNSRVCLQLVLGSWVGGFLLILPPTILVFQLPF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15912   145 CGPnVINHFFCDSGPLLKLSCSDT 168
7tmA_OR5A1-like cd15417
olfactory receptor subfamily 5A1 and related proteins, member of the class A family of ...
5-104 9.86e-32

olfactory receptor subfamily 5A1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5A1, 5A2, 5AN1, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320539  Cd Length: 279  Bit Score: 111.97  E-value: 9.86e-32
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15417    68 ISFVGCATQYFVFSGMGLTECFLLAAMAYDRYVAICNPLLYSVIMSPRLCVQLVAGAYLGGFLNSLIQTVSMFQLSFCgP 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15417   148 NVIDHFFCDIPPLLSLSCSDT 168
7tmA_OR4A-like cd15939
olfactory receptor 4A and related proteins, member of the class A family of ...
2-104 1.12e-31

olfactory receptor 4A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4A, 4C, 4P, 4S, 4X and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320605 [Multi-domain]  Cd Length: 267  Bit Score: 111.54  E-value: 1.12e-31
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15939    65 RKTISFNGCMTQLFAEHFFGGAEIFLLTVMAYDRYVAICKPLHYTTIMNRRVCGLLVGVAWVGGFLHSTIQILLTLQLPF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15939   145 CgPNVIDHFFCDLFPLLKLACTDT 168
7tmA_OR2T-like cd15421
olfactory receptor subfamily 2T and related proteins, member of the class A family of ...
2-104 2.17e-30

olfactory receptor subfamily 2T and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamilies 2T, 2M, 2L, 2V, 2Z, 2AE, 2AG, 2AK, 2AJ, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320543  Cd Length: 277  Bit Score: 108.79  E-value: 2.17e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15421    65 RKSISFVGCGTQIFFFLTLGGAECLLLALMAYDRYVAICHPLRYPVLMSPRVCLLMAAGSWLGGSLNSLIHTVYTMHFPY 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEVL-ITHYFCDILPLMKLSCSST 104
Cdd:cd15421   145 CGSReIHHFFCEVPALLKLSCADT 168
7tmA_OR7-like cd15234
olfactory receptor family 7 and related proteins, member of the class A family of ...
3-104 2.34e-30

olfactory receptor family 7 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 7 and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320362 [Multi-domain]  Cd Length: 277  Bit Score: 108.43  E-value: 2.34e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   3 NIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC 82
Cdd:cd15234    66 KSISYTGCLTQMCFFLLFGGLDNFLLAVMAYDRYVAICHPLHYTVIMNPCLCGLLVLLSLLISILDSLLHSLMVLQLSFC 145
                          90       100
                  ....*....|....*....|...
gi 1187838714  83 -EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15234   146 tDVEIPHFFCELAQVLKLACSDT 168
7tmA_OR10D-like cd15228
olfactory receptor subfamily 10D and related proteins, member of the class A family of ...
1-104 3.18e-30

olfactory receptor subfamily 10D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 10D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320356 [Multi-domain]  Cd Length: 275  Bit Score: 108.29  E-value: 3.18e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15228    64 QSRVISLGGCMSQVFFYHFLGSTECLLYTVMAYDRYVAICHPLRYLLIMNRRVCALLAAGTWITSSFHATILTSLTFTLP 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YC-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15228   144 YCgSNVVDYFFCDIFPVLKLACADT 168
7tmA_OR12D-like cd15915
olfactory receptor subfamily 12D and related proteins, member of the class A family of ...
5-104 5.76e-30

olfactory receptor subfamily 12D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 12D and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320581 [Multi-domain]  Cd Length: 271  Bit Score: 107.39  E-value: 5.76e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15915    68 ISFQGCISQLHFFHFLGSSEAMLLAVMAYDRYVAICNPLRYTVIMNPQVCLLLAVACWVTGFFHALMHTVMTSRLPFCGP 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15915   148 nKINHFFCDIKPLLKLACGDT 168
7tmA_OR5M-like cd15412
olfactory receptor subfamily 5M and related proteins, member of the class A family of ...
2-104 9.71e-30

olfactory receptor subfamily 5M and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5M and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320534  Cd Length: 279  Bit Score: 107.10  E-value: 9.71e-30
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15412    65 KKTISFAGCFTQCYFFIALVITEYYMLAVMAYDRYMAICNPLLYSVKMSRRVCISLVTFPYIYGFLNGLIQTILTFRLSF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15412   145 CgSNVINHFYCADPPLIKLSCSDT 168
7tmA_OR6B-like cd15224
olfactory receptor subfamily 6B and related proteins, member of the class A family of ...
5-102 2.02e-29

olfactory receptor subfamily 6B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6B, 6A, 6Y, 6P, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320352  Cd Length: 270  Bit Score: 105.83  E-value: 2.02e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15224    68 ISFVGCMTQLYFFLSLACTECVLLAVMAYDRYVAICHPLRYPVIMTHQLCVQLAAGSWLSGFLISMIKVYFISQLSFCGP 147
                          90
                  ....*....|....*....
gi 1187838714  85 -LITHYFCDILPLMKLSCS 102
Cdd:cd15224   148 nVINHFFCDISPLLNLSCT 166
7tmA_OR5J-like cd15415
olfactory receptor subfamily 5J and related proteins, member of the class A family of ...
5-104 2.76e-29

olfactory receptor subfamily 5J and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5J and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320537 [Multi-domain]  Cd Length: 279  Bit Score: 105.96  E-value: 2.76e-29
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15415    68 ISYSACIAQHFFFAVFVTTEGFLLAVMAYDRYVAICNPLLYTVAMTKRVCVQLVAGSYLGGLINSLTHTIGLLKLSFCGP 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15415   148 nVINHYFCDIPPLLKLSCSDT 168
7tmA_OR5G-like cd15414
olfactory receptor subfamily 5G and related proteins, member of the class A family of ...
2-104 1.11e-28

olfactory receptor subfamily 5G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320536 [Multi-domain]  Cd Length: 285  Bit Score: 104.43  E-value: 1.11e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15414    65 KKAISFLGCAAQMWFFGLFVAAECFLLASMAYDRYVAICNPLLYTVIMSQRVCVQLVVGPYVVGLLNTTTHTTAAFFLPF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15414   145 CgPNVINHFFCDIPPLLSLSCADT 168
7tmA_OR5H-like cd15409
olfactory receptor subfamily 5H and related proteins, member of the class A family of ...
1-104 1.61e-28

olfactory receptor subfamily 5H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5H, 5K, 5AC, 5T and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320531 [Multi-domain]  Cd Length: 279  Bit Score: 104.03  E-value: 1.61e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15409    64 KNKMISFSGCAAQFFFFGFSATTECFLLAAMAYDRYVAICNPLLYPVVMSNRLCVQLITASYIGGFLHSMIHVGLTFRLS 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15409   144 FCGSnEINHFFCDIPPLLKISCTDP 168
7tmA_OR8K-like cd15413
olfactory receptor subfamily 8K and related proteins, member of the class A family of ...
2-104 1.88e-28

olfactory receptor subfamily 8K and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 8K, 8U, 8J, 5R, 5AL and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320535  Cd Length: 279  Bit Score: 103.56  E-value: 1.88e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15413    65 QNTISFYACATQLAFFLTFIISELFLLSAMAYDRYVAICNPLLYTVIMSQRVCIVLVAIPYLYSFFVALFHTIKTFRLSF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15413   145 CGSnVINHFYCDDLPLLALSCSDT 168
7tmA_OR5B-like cd15407
olfactory receptor subfamily 5B and related proteins, member of the class A family of ...
3-104 3.28e-28

olfactory receptor subfamily 5B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5B and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320529  Cd Length: 279  Bit Score: 102.88  E-value: 3.28e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   3 NIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC 82
Cdd:cd15407    66 KVISYNACAAQMFFFVVFATVENFLLASMAYDRHAAVCKPLHYTTTMTTKVCACLTIGCYVCGFLNASIHTGNTFRLSFC 145
                          90       100
                  ....*....|....*....|...
gi 1187838714  83 E-VLITHYFCDILPLMKLSCSST 104
Cdd:cd15407   146 KsNVINHFFCDIPPVLALSCSDI 168
7tmA_OR8S1-like cd15229
olfactory receptor subfamily 8S1 and related proteins, member of the class A family of ...
1-104 3.77e-28

olfactory receptor subfamily 8S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 8S1 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320357 [Multi-domain]  Cd Length: 277  Bit Score: 102.67  E-value: 3.77e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15229    64 ERKTISVEGCIAQIFFFFFFAGTEAFLLSAMAYDRYAAICHPLHYVQIMSKQVCVQLVGGAWALGFLYALINTLLLLNLH 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15229   144 FCGPnEINHFSCELPSLLPLSCSDT 168
7tmA_OR4E-like cd15940
olfactory receptor 4E and related proteins, member of the class A family of ...
5-104 2.46e-27

olfactory receptor 4E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4E and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320606 [Multi-domain]  Cd Length: 267  Bit Score: 100.59  E-value: 2.46e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15940    68 ISFNGCVTQLFFLHLFACTEIFLLTIMAYDRYVAICNPLHYPTVMNHKVCLWLVAALWLGGTVHSLAQTFLTIRLPYCgP 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15940   148 NEIDSFFCDVPPVIKLACTDT 168
7tmA_OR9G-like cd15418
olfactory receptor subfamily 9G and related proteins, member of the class A family of ...
3-104 2.72e-27

olfactory receptor subfamily 9G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 9G and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320540 [Multi-domain]  Cd Length: 281  Bit Score: 100.63  E-value: 2.72e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   3 NIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC 82
Cdd:cd15418    67 KSISFAGCAAQFFFSAGLAYSECFLLAAMAYDRYVAICNPLLYSSAMSKKLCMGLVAASYLGGFANAIIHTSNTFRLHFC 146
                          90       100
                  ....*....|....*....|...
gi 1187838714  83 -EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15418   147 gDNIIDHFFCDLPPLVKLACDDT 169
7tmA_OR2-like cd15237
olfactory receptor family 2 and related proteins, member of the class A family of ...
1-104 3.65e-27

olfactory receptor family 2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 2 and 13, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320365 [Multi-domain]  Cd Length: 270  Bit Score: 100.04  E-value: 3.65e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15237    64 EHKTISFVGCAAQMFFFLALGVTECVLLAVMAYDRYVAICNPLRYSVIMSRRVCVRLAATSWASGFLNSLVLTSLTLRLP 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YC-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15237   144 FCgPNHINHFFCEAPAVLKLACADT 168
7tmA_OR2B-like cd15947
olfactory receptor subfamily 2B and related proteins, member of the class A family of ...
5-104 4.17e-27

olfactory receptor subfamily 2B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 2 (subfamilies 2B, 2C, 2G, 2H, 2I, 2J, 2W, 2Y) and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320613 [Multi-domain]  Cd Length: 270  Bit Score: 100.01  E-value: 4.17e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15947    68 ISYGGCVTQLYIFLWLGSTECVLLAVMAFDRYVAVCRPLHYTVIMHPRLCVQLAALSWLSGLANSLLQTTLTLQLPLCgH 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15947   148 HTLDHFFCEVPALIKLACVDT 168
7tmA_OR4-like cd15226
olfactory receptor family 4 and related proteins, member of the class A family of ...
2-104 5.10e-27

olfactory receptor family 4 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 4 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320354 [Multi-domain]  Cd Length: 267  Bit Score: 99.59  E-value: 5.10e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15226    65 HKTISFGGCMAQIFFLHFFGGSEMVLLIAMAFDRYVAICKPLHYLTIMSPRMCILLVVASWIIGFIHSLSQLAFVVNLPF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15226   145 CgPNVVDSFFCDLPLVIKLACTDT 168
7tmA_OR5P-like cd15416
olfactory receptor subfamily 5P and related proteins, member of the class A family of ...
2-104 1.15e-26

olfactory receptor subfamily 5P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5P and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320538 [Multi-domain]  Cd Length: 279  Bit Score: 98.98  E-value: 1.15e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15416    65 KTTISYPGCAAQLCSAATFGTVECFLLAAMAYDRYVAICNPLLYSTIMSQKVCVLLVAASYLGGCLNALVFTTCVFSLSF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15416   145 CgPNEINHFFCDFPPLLKLSCSDI 168
7tmA_OR5AR1-like cd15944
olfactory receptor subfamily 5AR1 and related proteins, member of the class A family of ...
1-104 1.50e-26

olfactory receptor subfamily 5AR1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5AR1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320610 [Multi-domain]  Cd Length: 294  Bit Score: 99.09  E-value: 1.50e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15944    77 KHKVISFSGCATQFAFFVGFVDAECYVLAAMAYDRYVAICNPLLYSTLMSKRVCLQLMAGSYLAGLVNLVIHTTATFSLS 156
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YC-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15944   157 FCgSNIINHFFCDVPPLLALSCSDT 181
7tmA_OR2A-like cd15420
olfactory receptor subfamily 2A and related proteins, member of the class A family of ...
5-104 3.25e-26

olfactory receptor subfamily 2A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2A and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320542 [Multi-domain]  Cd Length: 277  Bit Score: 97.78  E-value: 3.25e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15420    68 ISFAGCGTQMYLFLALAHTECVLLAVMSYDRYVAICHPLRYTVIMNWRVCTTLAATSWACGFLLALVHVVLLLRLPFCGP 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15420   148 nEVNHFFCEILAVLKLACADT 168
7tmA_OR13H-like cd15431
olfactory receptor subfamily 13H and related proteins, member of the class A family of ...
5-104 4.71e-25

olfactory receptor subfamily 13H and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 13H and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320548 [Multi-domain]  Cd Length: 269  Bit Score: 94.60  E-value: 4.71e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVdSTILTGLMIQLPYC-E 83
Cdd:cd15431    68 ISYSRCLAQMYISLFLGITECLLLAVMAYDRFVAICNPLRYTLIMSWRVCIQLAAGSWVSAFL-LTVIPVLTMPLHFCgP 146
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15431   147 NVINHFFCEVQALLKLACSDT 167
7tmA_OR5C1-like cd15945
olfactory receptor subfamily 5C1 and related proteins, member of the class A family of ...
5-104 4.80e-25

olfactory receptor subfamily 5C1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 5C1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320611  Cd Length: 292  Bit Score: 95.20  E-value: 4.80e-25
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15945    81 IPFYGCALQMFFFAAFADAECLLLAVMAYDRYVAICNPLLYTTAMSRRVCYLLLVGAYLSGMATSLVHTTLTFRLSFCgS 160
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15945   161 NTINHFFCDIPPLLALSCSDT 181
7tmA_OR4D-like cd15936
olfactory receptor 4D and related proteins, member of the class A family of ...
2-104 2.02e-24

olfactory receptor 4D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320602 [Multi-domain]  Cd Length: 267  Bit Score: 92.78  E-value: 2.02e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15936    65 TKTISFNGCMAQMFFFHFTGGAEVFLLSVMAYDRYIAIHKPLHYLTIMNQGVCTGLVAGSWLGGFAHSIVQVALLLQLPF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 CEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15936   145 CGPnVLDNFYCDVPQVIKLACTDT 168
7tmA_OR11G-like cd15913
olfactory receptor OR11G and related proteins, member of the class A family of ...
4-104 2.30e-24

olfactory receptor OR11G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 11G, 11H, and related proteins in other mammals, and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320579  Cd Length: 270  Bit Score: 92.76  E-value: 2.30e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   4 IISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC- 82
Cdd:cd15913    67 TISFSGCFLQFYFFFSLGTTECFFLSVMAFDRYLAICRPLHYPTIMTGQLCGKLVAFCWVCGFLWFLIPVVLISQLPFCg 146
                          90       100
                  ....*....|....*....|..
gi 1187838714  83 EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15913   147 PNIIDHFLCDPGPLLALSCVPA 168
7tmA_OR10G-like cd15916
olfactory receptor subfamily 10G and related proteins, member of the class A family of ...
4-104 2.61e-24

olfactory receptor subfamily 10G and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 10G, 10S, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320582 [Multi-domain]  Cd Length: 276  Bit Score: 92.90  E-value: 2.61e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   4 IISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC- 82
Cdd:cd15916    68 VISFGGCVAQLYFFHFLGSTECFLYTLMAYDRYLAICHPLHYPTIMTGRLCTRLATGTWVAGSLHSAIHTSLTFRLPFCg 147
                          90       100
                  ....*....|....*....|..
gi 1187838714  83 EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15916   148 PNRIDYFFCDIPPLLKLACADT 169
7tmA_OR13-like cd15430
olfactory receptor family 13 and related proteins, member of the class A family of ...
2-104 7.09e-24

olfactory receptor family 13 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 13 (subfamilies 13C, 13D, 13F, and 13J), some subfamilies from OR family 2 (2K and 2S), and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320547 [Multi-domain]  Cd Length: 270  Bit Score: 91.66  E-value: 7.09e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15430    65 RKTISFSGCAVQMYLSLAMGSTECVLLAVMAYDRYVAICNPLRYPIIMNKRLCVQMAAGSWVTGFLNSLVETVLAMQLPF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15430   145 CgNNVINHFTCEILAVLKLACVDI 168
7tmA_OR1E-like cd15236
olfactory receptor subfamily 1E and related proteins, member of the class A family of ...
5-104 8.95e-24

olfactory receptor subfamily 1E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 1E, 1J, and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320364 [Multi-domain]  Cd Length: 277  Bit Score: 91.37  E-value: 8.95e-24
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15236    68 IPYAGCISQMYFFIFFGCLDSFLLAVMAYDRYVAICHPLHYTAIMRPELCVLLVAGSWVLTCFHALLHTLLLARLSFCaD 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15236   148 NVIPHFFCDLVALLKLSCSST 168
7tmA_OR10G6-like cd15942
olfactory receptor subfamily 10G6 and related proteins, member of the class A family of ...
4-104 1.04e-23

olfactory receptor subfamily 10G6 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10G6 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320608  Cd Length: 275  Bit Score: 91.34  E-value: 1.04e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   4 IISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC- 82
Cdd:cd15942    67 IISFGGCVTQLFFFHFLGCAECFLYTVMAYDRFLAICKPLHYSTIMNHRACLCLSLGTWLGGCLHSTFQTSLTFRLPYGq 146
                          90       100
                  ....*....|....*....|..
gi 1187838714  83 EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15942   147 KNEVDYIFCDIPAMLKLACADT 168
7tmA_OR2B2-like cd15432
olfactory receptor subfamily 2B2 and related proteins, member of the class A family of ...
5-104 7.74e-23

olfactory receptor subfamily 2B2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes transmembrane olfactory receptor subfamily 2B2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320549 [Multi-domain]  Cd Length: 277  Bit Score: 89.07  E-value: 7.74e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15432    68 ISYGGCVAQLFIFLGLGSTECVLLAVMAFDRFAAICQPLHYSVIMHQRLCQQLAAGAWISGFANSLVQSTLTLKMPRCgR 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15432   148 RRVDHFFCEVPALLKLSCVDT 168
7tmA_OR4N-like cd15937
olfactory receptor 4N, 4M, and related proteins, member of the class A family of ...
1-104 1.12e-22

olfactory receptor 4N, 4M, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 4N, 4M, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320603  Cd Length: 267  Bit Score: 88.26  E-value: 1.12e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15937    64 ERKTISYGGCMAQLFFLHFLGAAEMFLLVAMAYDRYVAICKPLHYTTVVNRRVCCVLVGASWAGGFIHSIIQVALIIRLP 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YC-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15937   144 FCgPNVLDNFFCDITQVIKLACTNT 168
7tmA_OR4Q2-like cd15938
olfactory receptor 4Q2 and related proteins, member of the class A family of ...
2-104 1.90e-22

olfactory receptor 4Q2 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 4Q2 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320604 [Multi-domain]  Cd Length: 265  Bit Score: 87.62  E-value: 1.90e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15938    65 RKAISYEACIAQLFFLHFVGAAEMFLLTVMAYDRYVAICKPLHYTTIMSRRLCWVLVAASWAGGFLHSIVQTLLTIQLPF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15938   145 CgPNQVNNFFCDVPPVIKLACTDT 168
7tmA_OR6N-like cd15914
olfactory receptor OR6N and related proteins, member of the class A family of ...
1-104 2.40e-22

olfactory receptor OR6N and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 6N, 6K, and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320580 [Multi-domain]  Cd Length: 270  Bit Score: 87.43  E-value: 2.40e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15914    64 EEKTISFNGCLLQMYFFHSLGITECYLLTAMAYDRYLAICNPLHYPSIMTPKLCTQLAAGCWLCGFLGPVPEIILISTLP 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YCEV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15914   144 FCGPnQIQHIFCDFPPLLSLACTDT 168
7tmA_OR2W-like cd15434
olfactory receptor subfamily 2W and related proteins, member of the class A family of ...
5-104 2.87e-22

olfactory receptor subfamily 2W and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2W and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320551 [Multi-domain]  Cd Length: 277  Bit Score: 87.44  E-value: 2.87e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15434    68 ISYVGCAIQLFIALGLGGTECVLLAVMAYDRYAAVCQPLHYTVVMHPRLCWKLVAMSWLIGFGNSLVLSPLTLSLPRCgH 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15434   148 HRVDHFFCEMPALIKLACVDT 168
7tmA_OR1330-like cd15946
olfactory receptor 1330 and related proteins, member of the class A family of ...
1-104 4.24e-22

olfactory receptor 1330 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes olfactory receptors 1330 from mouse, Olr859 from rat, and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320612  Cd Length: 270  Bit Score: 86.76  E-value: 4.24e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15946    64 HKKTISFTGCVAQMYIFLALGITECTLFSVMAYDRYVAICHPLRYKVIMSWGLCILMVAGSWVCGVFSSLLHTFFTMRLP 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YC-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15946   144 YCgPNEINHYFCEVPAVLKLACADT 168
7tmA_OR3A-like cd15233
olfactory receptor subfamily 3A3 and related proteins, member of the class A family of ...
2-104 1.21e-21

olfactory receptor subfamily 3A3 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 3A3 and 3A4, and related proteins in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320361 [Multi-domain]  Cd Length: 277  Bit Score: 85.61  E-value: 1.21e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   2 KNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPY 81
Cdd:cd15233    65 KRTISYAACLSQLFFFHLLAGADCFLLTAMAYDRYLAICQPLTYSVRMSWRVQTALVGISCACAFTNALTHTVAMSTLKF 144
                          90       100
                  ....*....|....*....|....
gi 1187838714  82 C-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15233   145 CgPNVINHFFCDLPPLFQLSCSST 168
7tmA_OR2F-like cd15429
olfactory receptor subfamily 2F and related proteins, member of the class A family of ...
5-104 1.26e-21

olfactory receptor subfamily 2F and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2F and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320546 [Multi-domain]  Cd Length: 277  Bit Score: 85.92  E-value: 1.26e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15429    68 ISFASCVAQLFISLALGGTEFILLAVMAYDRYVAVCHPLRYTVIMSGGLCIQLAAASWTSGFLNSLVQTAFTFRLPFCGH 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15429   148 nTINHFSCELLAVVRLACVDT 168
7tmA_OR2D-like cd15428
olfactory receptor subfamily 2D and related proteins, member of the class A family of ...
1-104 4.45e-20

olfactory receptor subfamily 2D and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2D and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320545 [Multi-domain]  Cd Length: 277  Bit Score: 81.76  E-value: 4.45e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd15428    64 ERKIISFIRCAAQLYFFLSFGITECALLSVMSYDRYVAICLPLRYSLIMTWKVCISLATGSWVGGLLVSAVDTAFTLNLS 143
                          90       100
                  ....*....|....*....|....*
gi 1187838714  81 YC-EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15428   144 FGgHNKINHFLCEMPALLKLASTDT 168
7tmA_OR10S1-like cd15941
olfactory receptor subfamily 10S1 and related proteins, member of the class A family of ...
4-104 7.03e-20

olfactory receptor subfamily 10S1 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 10S1 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320607 [Multi-domain]  Cd Length: 277  Bit Score: 81.05  E-value: 7.03e-20
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   4 IISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC- 82
Cdd:cd15941    69 TISFEGCVVQLYAFHFLASTECFLYTVMAYDRYLAICHPLHYPTAMNRRMCAGLAGGTWATGATHAAIHTSLTFRLPYCg 148
                          90       100
                  ....*....|....*....|..
gi 1187838714  83 EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15941   149 PCQIAYFFCDIPPVLKLACADT 170
7tmA_OR4Q3-like cd15935
olfactory receptor 4Q3 and related proteins, member of the class A family of ...
3-104 3.66e-19

olfactory receptor 4Q3 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor 4Q3 and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320601 [Multi-domain]  Cd Length: 268  Bit Score: 79.04  E-value: 3.66e-19
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   3 NIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC 82
Cdd:cd15935    67 RTISFGGCMAQLFFLHFLGGSEMLLLTLMAYDRYVAICHPLRYLAVMNRQLCIKLLAACWAGGFLHSATQAALVLRLPFC 146
                          90       100
                  ....*....|....*....|...
gi 1187838714  83 -EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15935   147 gPNELDNFYCDVPQVIKLACMDT 169
7tmA_OR2Y-like cd15433
olfactory receptor subfamily 2Y and related proteins, member of the class A family of ...
4-104 1.55e-18

olfactory receptor subfamily 2Y and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 2Y, 2I, and related protein in other mammals. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320550 [Multi-domain]  Cd Length: 277  Bit Score: 77.52  E-value: 1.55e-18
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   4 IISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC- 82
Cdd:cd15433    67 TITRGGCVAQLFISLALGSAECVLLAVMAFDRYAAVCRPLHYAALMSPRLCQTLASISWLSGFVNSVAQTGLLAERPLCg 146
                          90       100
                  ....*....|....*....|..
gi 1187838714  83 EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15433   147 HRLLDHFFCEMPVFLKLACGDD 168
7tmA_OR2_unk cd15424
olfactory receptor family 2, unknown subfamily, member of the class A family of ...
4-104 1.19e-16

olfactory receptor family 2, unknown subfamily, member of the class A family of seven-transmembrane G protein-coupled receptors; This group represents an unknown subfamily, conserved in some mammalia and sauropsids, in family 2 of olfactory receptors. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320544 [Multi-domain]  Cd Length: 277  Bit Score: 72.46  E-value: 1.19e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   4 IISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC- 82
Cdd:cd15424    67 AISFARCTTQMYIALSLGSTECLLLGAMAYDRYLAICHPLLYAAAMGRWRQLQLALSCWAIGFLLSVINVGCTLRHPFCg 146
                          90       100
                  ....*....|....*....|..
gi 1187838714  83 EVLITHYFCDILPLMKLSCSST 104
Cdd:cd15424   147 PNHINHFFCELPVVLKLACADT 168
7tmA_OR56-like cd15223
olfactory receptor family 56 and related proteins, member of the class A family of ...
3-104 3.59e-16

olfactory receptor family 56 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 56 and related proteins in other mammals, sauropsids, and fishes. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320351 [Multi-domain]  Cd Length: 279  Bit Score: 71.17  E-value: 3.59e-16
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   3 NIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC 82
Cdd:cd15223    66 NTISLPGCFAQMFFIHFFTAMESSILLVMALDRYVAICKPLRYPSIITKSFILKLVLFALIRSGLLVLPIVVLASQLSYC 145
                          90       100
                  ....*....|....*....|...
gi 1187838714  83 EV-LITHYFCDILPLMKLSCSST 104
Cdd:cd15223   146 SSnVIEHCYCDHMALVSLACGDT 168
7tmA_OR52I-like cd15950
olfactory receptor subfamily 52I and related proteins, member of the class A family of ...
5-104 2.35e-15

olfactory receptor subfamily 52I and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52I and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320616  Cd Length: 275  Bit Score: 68.98  E-value: 2.35e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15950    68 ISFEACFTQMFFVHSFTAVESGVLLAMAFDRYVAICHPLRYSAILTSQVIAQIGLAIVLRALLFMTPLTCLVTSLPYCgS 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  84 VLITHYFCDILPLMKLSCSST 104
Cdd:cd15950   148 RVVPHSYCEHMAVVKLACADP 168
7tmA_OR52E-like cd15952
olfactory receptor subfamily 52E and related proteins, member of the class A family of ...
5-103 3.95e-15

olfactory receptor subfamily 52E and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52E and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320618  Cd Length: 274  Bit Score: 68.18  E-value: 3.95e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15952    68 ISFGGCLAQMFFIHTFTGMESAVLVAMAFDRYVAICNPLRYTTILTNKVISVIALGIVLRPLLLVLPFVFLILRLPFCGH 147
                          90       100
                  ....*....|....*....|
gi 1187838714  85 -LITHYFCDILPLMKLSCSS 103
Cdd:cd15952   148 nIIPHTYCEHMGIAKLACAS 167
7tmA_OR52B-like cd15221
olfactory receptor subfamily 52B and related proteins, member of the class A family of ...
5-103 7.15e-15

olfactory receptor subfamily 52B and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor (OR) subfamilies 52B, 52D, 52H and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320349  Cd Length: 275  Bit Score: 67.70  E-value: 7.15e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:cd15221    68 ISFDGCLTQMFFVHFVFVTESAILLAMAFDRYVAICYPLRYTTILTHSVIGKIGVAAVARSFCIVFPFVFLLKRLPYCgH 147
                          90       100
                  ....*....|....*....|
gi 1187838714  84 VLITHYFCDILPLMKLSCSS 103
Cdd:cd15221   148 NVIPHTYCEHMGIARLACAD 167
7tmA_OR51_52-like cd15917
olfactory receptor family 51, 52, 56 and related proteins, member of the class A family of ...
5-104 2.20e-14

olfactory receptor family 51, 52, 56 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor families 51, 52, 56, and related proteins in other mammals, sauropsids, amphibians, and fishes. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 341351  Cd Length: 275  Bit Score: 66.16  E-value: 2.20e-14
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15917    68 ISFDACLAQMFFIHSFTAMESGVLLAMAFDRYVAICYPLRYTTILTNTVVGKIGLAILLRAVALIIPLPLLVRRLPYCGS 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15917   148 nVISHSYCEHMAVVKLACGDT 168
7tmA_OR52P-like cd15953
olfactory receptor subfamily 52P and related proteins, member of the class A family of ...
5-104 1.42e-13

olfactory receptor subfamily 52P and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52P and related proteins in other mammals, sauropsids and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 341354  Cd Length: 275  Bit Score: 64.21  E-value: 1.42e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15953    68 ITFSGCLTQMFFIHTLSIMESAVLVAMAFDRYVAICNPLRYATILTNSRIAKLGLVGLIRGVLLILPLPLLLSRLPFCAN 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15953   148 rIIPHTYCEHMAVVKLACGDT 168
7tmA_OR52R_52L-like cd15951
olfactory receptor subfamily 52R, 52L, and related proteins, member of the class A family of ...
5-104 1.00e-12

olfactory receptor subfamily 52R, 52L, and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamilies 52R, 52L and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320617  Cd Length: 275  Bit Score: 61.98  E-value: 1.00e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15951    68 IDFSACLTQMFFIHSFSTMESGIFVAMALDRYVAICNPLRHSTILTNSVVAKIGLAVVLRGGILVSPHPFLLRRLPYCRT 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15951   148 nIIPHTYCEHMAVVKLACADT 168
7tmA_OR51-like cd15222
olfactory receptor family 51 and related proteins, member of the class A family of ...
5-104 4.89e-12

olfactory receptor family 51 and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor family 51 and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320350  Cd Length: 275  Bit Score: 59.82  E-value: 4.89e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15222    68 ISFDACLAQMFFIHTFSFMESSVLLAMAFDRFVAICNPLRYASILTNSRIAKIGLAIVLRSVLLLLPLPFLLKRLPFCHS 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15222   148 nVLSHSYCLHQDVMKLACSDT 168
7tmA_OR52K-like cd15948
olfactory receptor subfamily 52K and related proteins, member of the class A family of ...
5-104 8.56e-11

olfactory receptor subfamily 52K and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52K and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320614 [Multi-domain]  Cd Length: 277  Bit Score: 56.45  E-value: 8.56e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15948    69 INFNACLVQMFFLHSFSIMESAVLLAMAFDRYVAICNPLRYATILTNSVITKIGLAALARAVTLMTPLPFLLRRLPYCRS 148
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15948   149 hVIAHCYCEHMAVVKLACGDT 169
7tmA_OR52N-like cd15954
olfactory receptor subfamily 52N and related proteins, member of the class A family of ...
5-103 1.41e-09

olfactory receptor subfamily 52N and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52N and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320620  Cd Length: 276  Bit Score: 53.29  E-value: 1.41e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15954    68 ISFNACLVQMFFVHTFTGMESGVLMLMALDRYVAICYPLRYATILTNPVITKAGLATFLRGVMLIIPFPLLTKRLPYCRG 147
                          90       100
                  ....*....|....*....|
gi 1187838714  85 -LITHYFCDILPLMKLSCSS 103
Cdd:cd15954   148 nFIPHTYCDHMSVVKLACAN 167
7tm_4 pfam13853
Olfactory receptor; The members of this family are transmembrane olfactory receptors.
5-103 1.61e-09

Olfactory receptor; The members of this family are transmembrane olfactory receptors.


Pssm-ID: 404695  Cd Length: 278  Bit Score: 52.89  E-value: 1.61e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYC-E 83
Cdd:pfam13853  62 ISFEACLTQMFFIHKFSIMESAVLLAMAVDRFVAICSPLRYTTILTNPVISRIGLGVSVRSFILVLPLPFLLRRLPFCgH 141
                          90       100
                  ....*....|....*....|
gi 1187838714  84 VLITHYFCDILPLMKLSCSS 103
Cdd:pfam13853 142 HVLSHSYCLHMGLARLSCAD 161
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
5-101 3.91e-09

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 459624 [Multi-domain]  Cd Length: 256  Bit Score: 51.91  E-value: 3.91e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:pfam00001  53 FGSALCKIVGALFVVNGYASILLLTAISIDRYLAIVHPLRYKRRRTPRRAKVLILVIWVLALLLSLPPLLFGWTLTVPEG 132
                          90
                  ....*....|....*..
gi 1187838714  85 LIThyFCDILPLMKLSC 101
Cdd:pfam00001 133 NVT--VCFIDFPEDLSK 147
7tmA_OR52W-like cd15956
olfactory receptor subfamily 52W and related proteins, member of the class A family of ...
5-104 4.84e-09

olfactory receptor subfamily 52W and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52W and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320622 [Multi-domain]  Cd Length: 275  Bit Score: 51.79  E-value: 4.84e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15956    68 ISSYVCLSQMFLVHAFSAMESGVLVAMALDRFVAICNPLHYATILTLEVVAKAGLLLALRGVAIVIPFPLLVCRLSFCAS 147
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15956   148 hTIAHTYCEHMAVVKLACGAT 168
7tmA_OR52M-like cd15949
olfactory receptor subfamily 52M and related proteins, member of the class A family of ...
5-104 1.08e-06

olfactory receptor subfamily 52M and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52M and related proteins in other mammals, sauropsids, and amphibians. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320615  Cd Length: 292  Bit Score: 45.15  E-value: 1.08e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLPYCEV 84
Cdd:cd15949    84 IPLHACLLQMFLIHSFSAIESGIFLAMAFDRYVAICNPLRHKTILTNTTVIRIGLAAVIRGVLYISPLPLLVRRLPWYRT 163
                          90       100
                  ....*....|....*....|.
gi 1187838714  85 -LITHYFCDILPLMKLSCSST 104
Cdd:cd15949   164 nIIAHSYCEHMAVVGLACGDV 184
7tmA_OR52A-like cd15955
olfactory receptor subfamily 52A and related proteins, member of the class A family of ...
5-104 1.16e-06

olfactory receptor subfamily 52A and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes human olfactory receptor subfamily 52A and related proteins in other mammals and sauropsids. Olfactory receptors (ORs) play a central role in olfaction, the sense of smell. ORs belong to the class A rhodopsin-like family of G protein-coupled receptors and constitute the largest multigene family in mammals of approximately 1,000 genes. More than 60% of human ORs are non-functional pseudogenes compared to only about 20% in mouse. Each OR can recognize structurally similar odorants, and a single odorant can be detected by several ORs. Binding of an odorant to the olfactory receptor induces a conformational change that leads to the activation of the olfactory-specific G protein (Golf). The G protein (Golf and/or Gs) in turn stimulates adenylate cyclase to make cAMP. The cAMP opens cyclic nucleotide-gated ion channels, which allow the influx of calcium and sodium ions, resulting in depolarization of the olfactory receptor neuron and triggering an action potential which transmits this information to the brain. A consensus nomenclature system based on evolutionary divergence is used here to classify the olfactory receptor family. The nomenclature begins with the root name OR, followed by an integer representing a family, a letter denoting a subfamily, and an integer representing the individual gene within the subfamily.


Pssm-ID: 320621 [Multi-domain]  Cd Length: 276  Bit Score: 44.76  E-value: 1.16e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   5 ISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACsLLVAVVYIMGLVDSTILTGLMIQL---PY 81
Cdd:cd15955    68 ISFNACLAQMFFIHTLQAFESGILLAMALDRYVAICHPLRHSSILTPQVL-LGIGVLVVVRAVVLIIPCPLLIKLrlhHF 146
                          90       100
                  ....*....|....*....|...
gi 1187838714  82 CEVLITHYFCDILPLMKLSCSST 104
Cdd:cd15955   147 RSTVISHSYCEHMAVVKLAADDV 169
7tmA_Vasopressin_Oxytocin cd15196
vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G ...
15-70 1.01e-04

vasopressin and oxytocin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) and oxytocin are synthesized in the hypothalamus and are released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320324 [Multi-domain]  Cd Length: 264  Bit Score: 39.53  E-value: 1.01e-04
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*.
gi 1187838714  15 YFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIImSHQACSLLVAVVYIMGLVDST 70
Cdd:cd15196    78 YLQVVGMYASSYVLVATAIDRYIAICHPLSSHRW-TSRRVHLMVAIAWVLSLLLSI 132
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
1-98 2.52e-04

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 410626 [Multi-domain]  Cd Length: 275  Bit Score: 38.42  E-value: 2.52e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714   1 RKNIISYAGCMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDSTILTGLMIQLP 80
Cdd:cd00637    62 GRWWFGDALCKLLGFLQSVSLLASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLLIALIWLLSLLLALPPLLGWGVYD 141
                          90
                  ....*....|....*...
gi 1187838714  81 YCEVLITHYFCDILPLMK 98
Cdd:cd00637   142 YGGYCCCCLCWPDLTLSK 159
7tmA_amine_R-like cd14967
amine receptors and similar proteins, member of the class A family of seven-transmembrane G ...
10-95 5.67e-04

amine receptors and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Amine receptors of the class A family of GPCRs include adrenoceptors, 5-HT (serotonin) receptors, muscarinic cholinergic receptors, dopamine receptors, histamine receptors, and trace amine receptors. The receptors of amine subfamily are major therapeutic targets for the treatment of neurological disorders and psychiatric diseases. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320098 [Multi-domain]  Cd Length: 259  Bit Score: 37.16  E-value: 5.67e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1187838714  10 CMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVAVVYIMGLVDStiLTGLMIQLPYCEVLITHY 89
Cdd:cd14967    72 CRFWIALDVLCCTASILNLCAISLDRYLAITRPLRYRQLMTKKRALIMIAAVWVYSLLIS--LPPLVGWRDETQPSVVDC 149

                  ....*.
gi 1187838714  90 FCDILP 95
Cdd:cd14967   150 ECEFTP 155
7tmA_V2R cd15388
vasopressin receptor 2, member of the class A family of seven-transmembrane G protein-coupled ...
15-44 8.26e-04

vasopressin receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; The vasopressin type 2 receptor (V2R) is a G(s)-coupled receptor that controls balance of water and sodium ion by regulating their reabsorption in the renal collecting duct. Mutations of V2R is responsible for nephrogenic diabetes insipidus. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320510 [Multi-domain]  Cd Length: 295  Bit Score: 36.68  E-value: 8.26e-04
                          10        20        30
                  ....*....|....*....|....*....|
gi 1187838714  15 YFFVVLVIAESYMLTVMAYDRYAAICRPLL 44
Cdd:cd15388    78 YLQVVGMFASSYMIVAMTFDRHQAICRPMV 107
7tmA_V1bR cd15386
vasopressin receptor subtype 1B, member of the class A family of seven-transmembrane G ...
10-59 1.34e-03

vasopressin receptor subtype 1B, member of the class A family of seven-transmembrane G protein-coupled receptors; The V1b receptor is specifically expressed in corticotropes of the anterior pituitary and plays a critical role in regulating the activity of hypothalamic-pituitary-adrenal axis, a key part of the neuroendocrine system that controls reactions to stress, by maintaining adrenocorticotropic hormone (ACTH) and corticosterone levels. Vasopressin (also known as arginine vasopressin or anti-diuretic hormone) is synthesized in the hypothalamus and is released from the posterior pituitary gland. The actions of vasopressin are mediated by the interaction of this hormone with three receptor subtypes: V1aR, V1bR, and V2R. These subtypes are differ in localization, function, and signaling pathways. Activation of V1aR and V1bR stimulate phospholipase C, while activation of V2R stimulates adenylate cyclase. Although vasopressin and oxytocin differ only by two amino acids and stimulate the same cAMP/PKA pathway, they have divergent physiological functions. Vasopressin is involved in regulating blood pressure and the balance of water and sodium ions, whereas oxytocin plays an important role in the uterus during childbirth and in lactation.


Pssm-ID: 320508 [Multi-domain]  Cd Length: 302  Bit Score: 36.31  E-value: 1.34e-03
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|
gi 1187838714  10 CMSQLYFFVVLVIAESYMLTVMAYDRYAAICRPLLYNIIMSHQACSLLVA 59
Cdd:cd15386    73 CRAVKYLQVLSMFASTYMLIMMTVDRYIAVCHPLRTLQQPSRQAYLMIGA 122
7tmA_Vasopressin-like cd14986
vasopressin receptors and its related G protein-coupled receptors, member of the class A ...
15-43 2.91e-03

vasopressin receptors and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this group form a subfamily within the class A G-protein coupled receptors (GPCRs), which includes the vasopressin and oxytocin receptors, the gonadotropin-releasing hormone receptors (GnRHRs), the neuropeptide S receptor (NPSR), and orphan GPR150. These receptors share significant sequence homology with each other, suggesting that they have a common evolutionary origin. Vasopressin, also known as arginine vasopressin or anti-diuretic hormone, is a neuropeptide synthesized in the hypothalamus. The actions of vasopressin are mediated by the interaction of this hormone with three tissue-specific subtypes: V1AR, V1BR, and V2R. Although vasopressin differs from oxytocin by only two amino acids, they have divergent physiological functions. Vasopressin is involved in regulating osmotic and cardiovascular homeostasis, whereas oxytocin plays an important role in the uterus during childbirth and in lactation. GnRHR, also known as luteinizing hormone releasing hormone receptor (LHRHR), plays an central role in vertebrate reproductive function; its activation by binding to GnRH leads to the release of follicle stimulating hormone (FSH) and luteinizing hormone (LH) from the pituitary gland. Neuropeptide S (NPS) promotes arousal and anxiolytic-like effects by activating its cognate receptor NPSR. NPSR has also been associated with asthma and allergy. GPR150 is an orphan receptor closely related to the oxytocin and vasopressin receptors.


Pssm-ID: 320117 [Multi-domain]  Cd Length: 295  Bit Score: 35.43  E-value: 2.91e-03
                          10        20
                  ....*....|....*....|....*....
gi 1187838714  15 YFFVVLVIAESYMLTVMAYDRYAAICRPL 43
Cdd:cd14986    78 YLQVVGLFASTYILVSMSLDRYQAIVKPM 106
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH