NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|2192318707|gb|KAH9766647|]
View 

Chromatin structure-remodeling complex protein BSH [Citrus sinensis]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

 Name Accession Description Interval E-value
SNF5 super family cl20277
SNF5 / SMARCB1 / INI1; SNF5 is a component of the yeast SWI/SNF complex, which is an ...
 21-141 4.10e-27

SNF5 / SMARCB1 / INI1; SNF5 is a component of the yeast SWI/SNF complex, which is an ATP-dependent nucleosome-remodelling complex that regulates the transcription of a subset of yeast genes. SNF5 is a key component of all SWI/SNF-class complexes characterized so far. This family consists of the conserved region of SNF5, including a direct repeat motif. SNF5 is essential for the assembly promoter targeting and chromatin remodelling activity of the SWI-SNF complex. SNF5 is also known as SMARCB1, for SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin, subfamily b, member 1, and also INI1 for integrase interactor 1. Loss-of function mutations in SNF5 are thought to contribute to oncogenesis in malignant rhabdoid tumours (MRTs).


The actual alignment was detected with superfamily member pfam04855:

Pssm-ID: 428158  Cd Length: 186  Bit Score: 102.27  E-value: 4.10e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2192318707  21 DNLVPIRLDIETEGQRYKDAFTWNPSDPDSEVVVFAKRTVRDLKLP----PQFITQIAQSIQTQLTEFRSYEGQDMYTAE 96
Cdd:pfam04855   4 ETLVPIRIDLDIDKYRLRDTFTWNLHETLITPEQFAQTLCEDLDLPnepaPAFADQIAKQIREQLEEYAGVALHPLPYPH 83

                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2192318707  97 KIVP--------------------IK----------------DLNNYESDPEEFARTFCNDMGIEdPEVGPAVAFAIREQ 140
Cdd:pfam04855  84 VEEEddpldpdlpylnpdddlrilIKlditignhlltdqfewDLLSPLNTPEEFAKQTCADLGLS-GEFVTAIAHAIREQ 162


                  .
gi 2192318707 141 L 141
Cdd:pfam04855 163 V 163
 
Name Accession Description Interval E-value
SNF5 pfam04855
SNF5 / SMARCB1 / INI1; SNF5 is a component of the yeast SWI/SNF complex, which is an ...
 21-141 4.10e-27

SNF5 / SMARCB1 / INI1; SNF5 is a component of the yeast SWI/SNF complex, which is an ATP-dependent nucleosome-remodelling complex that regulates the transcription of a subset of yeast genes. SNF5 is a key component of all SWI/SNF-class complexes characterized so far. This family consists of the conserved region of SNF5, including a direct repeat motif. SNF5 is essential for the assembly promoter targeting and chromatin remodelling activity of the SWI-SNF complex. SNF5 is also known as SMARCB1, for SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin, subfamily b, member 1, and also INI1 for integrase interactor 1. Loss-of function mutations in SNF5 are thought to contribute to oncogenesis in malignant rhabdoid tumours (MRTs).


Pssm-ID: 428158  Cd Length: 186  Bit Score: 102.27  E-value: 4.10e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2192318707  21 DNLVPIRLDIETEGQRYKDAFTWNPSDPDSEVVVFAKRTVRDLKLP----PQFITQIAQSIQTQLTEFRSYEGQDMYTAE 96
Cdd:pfam04855   4 ETLVPIRIDLDIDKYRLRDTFTWNLHETLITPEQFAQTLCEDLDLPnepaPAFADQIAKQIREQLEEYAGVALHPLPYPH 83

                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2192318707  97 KIVP--------------------IK----------------DLNNYESDPEEFARTFCNDMGIEdPEVGPAVAFAIREQ 140
Cdd:pfam04855  84 VEEEddpldpdlpylnpdddlrilIKlditignhlltdqfewDLLSPLNTPEEFAKQTCADLGLS-GEFVTAIAHAIREQ 162


                  .
gi 2192318707 141 L 141
Cdd:pfam04855 163 V 163
 
Name Accession Description Interval E-value
SNF5 pfam04855
SNF5 / SMARCB1 / INI1; SNF5 is a component of the yeast SWI/SNF complex, which is an ...
 21-141 4.10e-27

SNF5 / SMARCB1 / INI1; SNF5 is a component of the yeast SWI/SNF complex, which is an ATP-dependent nucleosome-remodelling complex that regulates the transcription of a subset of yeast genes. SNF5 is a key component of all SWI/SNF-class complexes characterized so far. This family consists of the conserved region of SNF5, including a direct repeat motif. SNF5 is essential for the assembly promoter targeting and chromatin remodelling activity of the SWI-SNF complex. SNF5 is also known as SMARCB1, for SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin, subfamily b, member 1, and also INI1 for integrase interactor 1. Loss-of function mutations in SNF5 are thought to contribute to oncogenesis in malignant rhabdoid tumours (MRTs).


Pssm-ID: 428158  Cd Length: 186  Bit Score: 102.27  E-value: 4.10e-27
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2192318707  21 DNLVPIRLDIETEGQRYKDAFTWNPSDPDSEVVVFAKRTVRDLKLP----PQFITQIAQSIQTQLTEFRSYEGQDMYTAE 96
Cdd:pfam04855   4 ETLVPIRIDLDIDKYRLRDTFTWNLHETLITPEQFAQTLCEDLDLPnepaPAFADQIAKQIREQLEEYAGVALHPLPYPH 83

                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2192318707  97 KIVP--------------------IK----------------DLNNYESDPEEFARTFCNDMGIEdPEVGPAVAFAIREQ 140
Cdd:pfam04855  84 VEEEddpldpdlpylnpdddlrilIKlditignhlltdqfewDLLSPLNTPEEFAKQTCADLGLS-GEFVTAIAHAIREQ 162


                  .
gi 2192318707 141 L 141
Cdd:pfam04855 163 V 163
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH