conserved catalytic core domain of RNA-dependent RNA polymerase (RdRp) from the positive-sense single-stranded RNA [(+)ssRNA] viruses and closely related viruses; This family contains the catalytic core domain of RdRp of RNA viruses which belong to Group IV of the Baltimore classification system, and are a group of related viruses that have positive-sense (+), single-stranded (ss) genomes made of ribonucleic acid (RNA). RdRp (also known as RNA replicase) catalyzes the replication of RNA from an RNA template; specifically, it catalyzes the synthesis of the RNA strand complementary to a given RNA template. The Baltimore Classification is divided into 7 classes, 3 of which include RNA viruses: Group IV (+) RNA viruses, Group III double-stranded (ds) RNA viruses, and Group V negative-sense (-) RNA viruses. Baltimore groups of viruses differ with respect to the nature of their genome (i.e., the nucleic acid form that is packaged into virions) and correspond to distinct strategies of genome replication and expression. (+) viral RNA is similar to mRNA and thus can be immediately translated by the host cell. (+)ssRNA viruses can also produce (+) copies of the genome from (-) strands of an intermediate dsRNA genome. This acts as both a transcription and a replication process since the replicated RNA is also mRNA. RdRps belong to the expansive class of polymerases containing so-called palm catalytic domains along with the accessory fingers and thumb domains. All RdRps also have six conserved structural motifs (A-F), located in its majority in the palm subdomain (A-E motifs) and the F motif is located on the finger subdomain. All these motifs have been shown to be implicated in RdRp fidelity such as processes of correct incorporation and reorganization of nucleotides. In addition to Group IV viruses, this model also includes Picobirnaviruses (PBVs), members of the family Picobirnaviridae of dsRNA viruses (Baltimore classification Group III), which are bi-segmented dsRNA viruses. The phylogenetic tree of the RdRps of RNA viruses (realm Riboviria) showed that picobirnaviruses are embedded in the branch of diverse (+)RNA viruses; sometimes they are collectively referred to as the picornavirus supergroup. RdRps of members of the family Permutatetraviridae, a distinct group of RNA viruses that encompass a circular permutation within the RdRp palm domain, are not included in this model.

                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2235495003   8 KQEWGQLMGSPVSFPILCLINMALTRYAMEQRGGRRIPLRDSGILVNGDDVGFVTDQTGYELWKETTACGGLEPSLGKNF 87
Cdd:cd23183   131 VQTRGQLMGSLLSFPLLCIINKAVFRYALEDLLGSGKELTEHPVLINGDDILFRGPRRLYARWRRVVSAVGLVVSPGKTF 210

                          90
                  ....*....|..
gi 2235495003  88 CSRDFVVLNSTF 99
Cdd:cd23183   211 VSPRYAELNSTL 222

catalytic core domain of RNA-dependent RNA polymerase (RdRp) in the family Botourmiaviridae of positive-sense single-stranded RNA [(+)ssRNA] viruses; This group contains the catalytic core domain of RdRp of RNA viruses belonging to the family Botourmiaviridae, order Ourlivirales. The family includes six genera: Ourmiavirus, Botoulivirus, Magoulivirus, Penoulivirus, Rhizoulivirus and Scleroulivirus. Family Botourmiaviridae genomes can be monopartite (Botoulivirus, Magoulivirus, Penoulivirus, Rhizoulivirus and Scleroulivirus) (2-3 kb) or tripartate (Ourmiavirus). Members of genus Ourmiavirus infect plants and the other genera infect fungi. Members of the genera Botoulivirus, Magoulivirus and Scleroulivirus infect fungi from the genera Botrytis, Magnaporthe or Sclerotinia, respectively. Members of the genus Ourmiavirus infect plants: Ourmia melon virus infects melon, producing chlorotic spots and irregular ringspots, Epirus cherry virus produces rasp-leaf symptoms in cherry, and cassava virus C induces severe stunting and a yellow mosaic pattern in cassava. Ourmiavirus replication is dependent on the virus RdRp. Synthesis of the ourmiavirus coat protein from actively replicating RNA3 is necessary for both virion assembly and systemic infection of the host. The ourmiavirus movement protein determines symptoms and forms tubular structures involved in cell-to-cell movement and may undergo post-translational modification. Botoulivirus, magoulivirus and scleroulivirus replication is strictly dependent on the virus RNA-dependent RNA polymerase. The RdRp domain displays a right hand with three functional subdomains, called fingers, palm, and thumb. All RdRps contain conserved polymerase motifs (A-G), located in the palm (A-E motifs) and finger (F-G) subdomains. All these motifs have been implicated in RdRp fidelity such as processes of correct incorporation and reorganization of nucleotides.

                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2235495003   8 KQEWGQLMGSPVSFPILCLINMALTRYAMEQRGGRRIPLRDSGILVNGDDVGFVTDQTGYELWKETTACGGLEPSLGKNF 87
Cdd:cd23183   131 VQTRGQLMGSLLSFPLLCIINKAVFRYALEDLLGSGKELTEHPVLINGDDILFRGPRRLYARWRRVVSAVGLVVSPGKTF 210

                          90
                  ....*....|..
gi 2235495003  88 CSRDFVVLNSTF 99
Cdd:cd23183   211 VSPRYAELNSTL 222

catalytic core domain of RNA-dependent RNA polymerase (RdRp) in the family Botourmiaviridae of positive-sense single-stranded RNA [(+)ssRNA] viruses; This group contains the catalytic core domain of RdRp of RNA viruses belonging to the family Botourmiaviridae, order Ourlivirales. The family includes six genera: Ourmiavirus, Botoulivirus, Magoulivirus, Penoulivirus, Rhizoulivirus and Scleroulivirus. Family Botourmiaviridae genomes can be monopartite (Botoulivirus, Magoulivirus, Penoulivirus, Rhizoulivirus and Scleroulivirus) (2-3 kb) or tripartate (Ourmiavirus). Members of genus Ourmiavirus infect plants and the other genera infect fungi. Members of the genera Botoulivirus, Magoulivirus and Scleroulivirus infect fungi from the genera Botrytis, Magnaporthe or Sclerotinia, respectively. Members of the genus Ourmiavirus infect plants: Ourmia melon virus infects melon, producing chlorotic spots and irregular ringspots, Epirus cherry virus produces rasp-leaf symptoms in cherry, and cassava virus C induces severe stunting and a yellow mosaic pattern in cassava. Ourmiavirus replication is dependent on the virus RdRp. Synthesis of the ourmiavirus coat protein from actively replicating RNA3 is necessary for both virion assembly and systemic infection of the host. The ourmiavirus movement protein determines symptoms and forms tubular structures involved in cell-to-cell movement and may undergo post-translational modification. Botoulivirus, magoulivirus and scleroulivirus replication is strictly dependent on the virus RNA-dependent RNA polymerase. The RdRp domain displays a right hand with three functional subdomains, called fingers, palm, and thumb. All RdRps contain conserved polymerase motifs (A-G), located in the palm (A-E motifs) and finger (F-G) subdomains. All these motifs have been implicated in RdRp fidelity such as processes of correct incorporation and reorganization of nucleotides.

                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2235495003   8 KQEWGQLMGSPVSFPILCLINMALTRYAMEQRGGRRIPLRDSGILVNGDDVGFVTDQTGYELWKETTACGGLEPSLGKNF 87
Cdd:cd23183   131 VQTRGQLMGSLLSFPLLCIINKAVFRYALEDLLGSGKELTEHPVLINGDDILFRGPRRLYARWRRVVSAVGLVVSPGKTF 210

                          90
                  ....*....|..
gi 2235495003  88 CSRDFVVLNSTF 99
Cdd:cd23183   211 VSPRYAELNSTL 222

RNA_dep_RNAP: RNA-dependent RNA polymerase (RdRp) is an essential protein encoded in the genomes of all RNA containing viruses with no DNA stage. RdRp catalyzes synthesis of the RNA strand complementary to a given RNA template. RdRps of many viruses are products of processing of polyproteins. Some RdRps consist of one polypeptide chain, and others are complexes of several subunits. The domain organization and the 3D structure of the catalytic center of a wide range of RdRps, including those with a low overall sequence homology, are conserved. The catalytic center is formed by several motifs containing a number of conserved amino acid residues. This subfamily represents the RNA-dependent RNA polymerases from all positive-strand RNA eukaryotic viruses with no DNA stage.

                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2235495003  25 CLINMALTRYAMEQRGGRRIPlRDSGILVNGDD-VGFVTDQTGY---ELWKETTACGGLEPSLGK------------NFC 88
Cdd:cd01699   172 SIINCILVRYAFRKLGGKSFF-KNVRLLNYGDDcLLSVEKADDKfnlETLAEWLKEYGLTMTDEDkvespfrpleevEFL 250

                          90
                  ....*....|..
gi 2235495003  89 SRDFVVLNSTFH 100
Cdd:cd01699   251 KRRFVLDEGGGW 262