NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1019031930|ref|NP_001309958|]
View 

dynein regulatory complex protein 9 isoform c [Homo sapiens]

Protein Classification

coiled-coil domain-containing protein( domain architecture ID 1000037)

coiled-coil domain-containing protein contains a region with alpha-helical coiled-coil sequence signatures that is being annotated by a variety of protein family models, not necessarily indicating family membership

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IQCG cd23766
IQ (isoleucine-glutamine) motif containing G (IQCG); IQCG, also called dynein regulatory ...
286-324 1.07e-08

IQ (isoleucine-glutamine) motif containing G (IQCG); IQCG, also called dynein regulatory complex protein 9 (DRC9), belongs to the IQ motif-containing protein family which contains a C-terminal conserved IQ (isoleucine-glutamine) motif and a coiled-coil domain. The IQ motif ([ILV]QxxxRxxxx[RK]), where x stands for any amino-acid residue, interacts with calmodulin (CaM) in a calcium-independent manner and is present in proteins with a wide diversity of biological functions. The expression of IQCG is reduced in the sperm of human asthenospermia patients whose sperm have reduced mobility. It has also been shown to have a role in the calmodulin-mediated calcium signaling pathway in zebrafish haematopoietic development. The human IQCG gene was first reported to be involved in chromosome translocation in a case of acute lymphoid/myeloid leukemia. It expresses predominantly at mice testis during spermatogenesis which interacts with calmodulin in a calcium-dependent manner in the mouse testis. IQCG knockout mice are sterile due to the total immobility of their spermatozoa.


:

Pssm-ID: 467744  Cd Length: 40  Bit Score: 50.24  E-value: 1.07e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1019031930 286 KKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPKDK 324
Cdd:cd23766     1 RREKEQEELELRAAIKIQAWWRGIMVRKGLGPFKKKKKK 39
 
Name Accession Description Interval E-value
IQCG cd23766
IQ (isoleucine-glutamine) motif containing G (IQCG); IQCG, also called dynein regulatory ...
286-324 1.07e-08

IQ (isoleucine-glutamine) motif containing G (IQCG); IQCG, also called dynein regulatory complex protein 9 (DRC9), belongs to the IQ motif-containing protein family which contains a C-terminal conserved IQ (isoleucine-glutamine) motif and a coiled-coil domain. The IQ motif ([ILV]QxxxRxxxx[RK]), where x stands for any amino-acid residue, interacts with calmodulin (CaM) in a calcium-independent manner and is present in proteins with a wide diversity of biological functions. The expression of IQCG is reduced in the sperm of human asthenospermia patients whose sperm have reduced mobility. It has also been shown to have a role in the calmodulin-mediated calcium signaling pathway in zebrafish haematopoietic development. The human IQCG gene was first reported to be involved in chromosome translocation in a case of acute lymphoid/myeloid leukemia. It expresses predominantly at mice testis during spermatogenesis which interacts with calmodulin in a calcium-dependent manner in the mouse testis. IQCG knockout mice are sterile due to the total immobility of their spermatozoa.


Pssm-ID: 467744  Cd Length: 40  Bit Score: 50.24  E-value: 1.07e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1019031930 286 KKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPKDK 324
Cdd:cd23766     1 RREKEQEELELRAAIKIQAWWRGIMVRKGLGPFKKKKKK 39
 
Name Accession Description Interval E-value
IQCG cd23766
IQ (isoleucine-glutamine) motif containing G (IQCG); IQCG, also called dynein regulatory ...
286-324 1.07e-08

IQ (isoleucine-glutamine) motif containing G (IQCG); IQCG, also called dynein regulatory complex protein 9 (DRC9), belongs to the IQ motif-containing protein family which contains a C-terminal conserved IQ (isoleucine-glutamine) motif and a coiled-coil domain. The IQ motif ([ILV]QxxxRxxxx[RK]), where x stands for any amino-acid residue, interacts with calmodulin (CaM) in a calcium-independent manner and is present in proteins with a wide diversity of biological functions. The expression of IQCG is reduced in the sperm of human asthenospermia patients whose sperm have reduced mobility. It has also been shown to have a role in the calmodulin-mediated calcium signaling pathway in zebrafish haematopoietic development. The human IQCG gene was first reported to be involved in chromosome translocation in a case of acute lymphoid/myeloid leukemia. It expresses predominantly at mice testis during spermatogenesis which interacts with calmodulin in a calcium-dependent manner in the mouse testis. IQCG knockout mice are sterile due to the total immobility of their spermatozoa.


Pssm-ID: 467744  Cd Length: 40  Bit Score: 50.24  E-value: 1.07e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 1019031930 286 KKKVKQDLLELKSVIKLQAWWRGTMIRREIGGFKMPKDK 324
Cdd:cd23766     1 RREKEQEELELRAAIKIQAWWRGIMVRKGLGPFKKKKKK 39
IQCG-IQCD cd21098
IQ (isoleucine-glutamine) motif containing G and D (IQCG and IQCD); IQCG and IQCD belong to ...
291-313 3.16e-05

IQ (isoleucine-glutamine) motif containing G and D (IQCG and IQCD); IQCG and IQCD belong to the IQ motif-containing protein family which contain a C-terminal conserved IQ (isoleucine-glutamine) motif and a coiled-coil domain. The IQCG protein (also known as DRC9 and CFAP122) is essential for sperm flagellum formation in mice. The IQCD protein (also known as DRC10) is involved in sperm fertilization and the acrosome reaction. Both proteins are components of the nexin-dynein regulatory complex (N-DRC), a key regulator of ciliary/flagellar motility. IQCG and IQCD proteins contain a central coiled-coil domain and a C-terminal IQ (isoleucine-glutamine) motif ([ILV]QxxxRxxxx[RK]), where x stands for any amino-acid residue, that interacts with calmodulin (CaM) in a calcium-independent manner. IQ motif-containing proteins that are known to bind calmodulin (CaM) have a wide diversity of biological functions, and they include neuronal growth proteins, myosins, voltage-operated channels, phosphatases, Ras exchange proteins, sperm surface proteins, Ras Gap-like proteins, spindle-associated proteins, and several proteins in plants.


Pssm-ID: 467743  Cd Length: 25  Bit Score: 40.43  E-value: 3.16e-05
                          10        20
                  ....*....|....*....|...
gi 1019031930 291 QDLLELKSVIKLQAWWRGTMIRR 313
Cdd:cd21098     3 EDERELWAATKIQALWRGYMVRR 25
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.21
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Wang J et al. (2023), "The conserved domain database in 2023", Nucleic Acids Res.51(D)384-8.
  • Lu S et al. (2020), "The conserved domain database in 2020", Nucleic Acids Res.48(D)265-8.
  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH