Molecular Imaging and Contrast Agent Database (MICAD)

NCBI Bookshelf. A service of the National Library of Medicine, National Institutes of Health.

Molecular Imaging and Contrast Agent Database (MICAD)

Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.

MICAD is a key component of the NIH Common Fund (formerly NIH Roadmap); it is developed by the National Center for Biotechnology Information (NCBI), at the National Institutes of Health (NIH). More about MICAD »

After June 30 of 2013, new and revised chapters will no longer be uploaded to the MICAD website. However, the current chapters remain available online.

1444 agents currently listed. Latest update: June 27, 2013.

MICAD available through PubMed: MICAD chapters are now accessible through PubMed. To retrieve a list of all MICAD records, query PubMed for "Molecular Imaging and Contrast Agent Database (MICAD)"[book].

FDA Approved Contrast Agents: Download a list of FDA approved contrast agents (Latest update: January 2013).

Molecular Imaging Probes and Contrast Agents List: The MICAD staff has created the Molecular Imaging Probes and Contrast Agents List (MIP & CA List) by screening the PubMed/MedLine databases and other appropriate sources of such information. Only agents used in animal or human studies yielding in vivo data were selected for inclusion in the list. Although great care has been taken to accurately present all and only those imaging and contrast agents that fulfill the in vivo data criteria, this list is by no means considered complete. No one imaging modality has been given preference over the others and the omission of any agent(s) or the introduction of any errors in the list is purely unintentional. The MIP & CA List is subject to the same copyright and disclaimers as the rest of the MICAD content. Please read carefully the complete disclaimer information for MICAD before using the list. Download the list (Latest update: January 2013).

About MICAD
MRI
- 13C
  - Hyperpolarized [1,4-¹³C₂]fumarate as an imaging agent of tumor cell death in vivo [PDF Version]
    [1,4-¹³C₂]Fumarate
    Liang Shan.
    Created: January 15, 2010; Last Update: April 12, 2010.
  - Hyperpolarized [1-¹³C]dehydroascorbic acid [PDF Version]
    [1-¹³C]DHA
    Kam Leung.
    Created: September 15, 2011; Last Update: December 15, 2011.
  - Hyperpolarized [¹³C]-2-hydroxyethylpropionate [PDF Version]
    HP[¹³C]HEPP
    Huiming Zhang.
    Created: January 31, 2008; Last Update: March 5, 2008.
  - Hyperpolarized ¹³C-labeled bicarbonate (H¹³CO₃^-) for in vivo pH measurement with ¹³C magnetic resonance spectroscopy [PDF Version]
    Hyperpolarized H¹³CO₃^-
    Liang Shan.
    Created: January 25, 2010; Last Update: April 12, 2010.
  - Hyperpolarized sodium 1-[¹³C]pyruvate [PDF Version]
    HP[¹³C]Pyr
    Huiming Zhang.
    Created: January 29, 2008; Last Update: February 28, 2008.
  - Hyperpolarized α-keto[1-¹³C]isocaproate as a ¹³C magnetic resonance spectroscopic agent for profiling branched chain amino acid metabolism in tumors [PDF Version]
    [1-¹³C]KIC
    Liang Shan.
    Created: January 15, 2010; Last Update: May 19, 2010.
- 19F
  - 6-Fluoropyridoxol [PDF Version]
    6-FPOL
    Kenneth T. Cheng.
    Created: May 9, 2006; Last Update: March 25, 2008.
  - Aqueous colloidal nanoemulsion of perfluorocarbon polymers [PDF Version]
    CS-1000
    Liang Shan.
    Created: February 24, 2011; Last Update: March 31, 2011.
  - Perfluoro-15-crown-5 ether-labeled dendritic cells [PDF Version]
    PFPE-DCs
    Huiming Zhang.
    Created: August 1, 2008; Last Update: September 3, 2008.
  - Perfluoropolyethylene glycol–labeled BDC2.5 T cells [PDF Version]
    PFPE-BTCs
    Huiming Zhang.
    Created: August 8, 2008; Last Update: September 16, 2008.
  - VHPKQHRGGSKGC-liquid perfluorocarbon nanoparticles [PDF Version]
    VCAM-1-targeted NPs
    Kam Leung.
    Created: February 28, 2010; Last Update: April 1, 2010.
- Cu
  - Au₃Cu₁ Nanoparticles [PDF Version]
    Au₃Cu₁-NPs
    Kam Leung.
    Created: June 26, 2008; Last Update: August 18, 2008.
- Europium
  - Eu-1,7-Bis(2-(methylene benzyloxy ether)-acetic acid) acetamide-4,10-bis(acetamidoacetic acid)-1,4,7,10- tetraazacyclododecane [PDF Version]
    Eu-DOTA-OBZ₂-Gly₂
    Mark Pagel and Kam Leung.
    Created: February 19, 2009; Last Update: March 10, 2009.
- Fe
  - BM3h-8C8 Mutant of the heme domain of the bacterial cytochrome P450-BM3 (Bacillus megaterium) [PDF Version]
    BM3h-8C8
    Liang Shan.
    Created: December 17, 2010; Last Update: January 18, 2011.
- Gadolinium
  - (1-(2-(β-Galactopyranosyloxy)propyl)-4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecane) gadolinium(III) [PDF Version]
    EGadMe
    Huiming Zhang.
    Created: January 14, 2008; Last Update: February 20, 2008.
  - (Gd-chelate)₂-Phe-His-Cys-Pro(OH)-Tyr(2-Cl)-Asp-Leu-Cys-His-Ile-Leu-(Gd-chelate)₂ [PDF Version]
    4Gdpeptide
    Huiming Zhang.
    Created: November 15, 2007; Last Update: January 8, 2008.
  - [(Biotin-Ala-Ser-Lys-Lys-Pro-Lys-Arg-Asn-Ile-Lys-Ala)₄-dendrimer]-streptavidin-[biotin-gadolinium 1,4,7-tris(carboxymethyl)-10-(2’-hydroxypropyl)-1,4,7,10-tetraazacyclododecane-loaded apoferritin] [PDF Version]
    C3d-SA-GdAF
    Huiming Zhang.
    Created: December 27, 2007; Last Update: February 4, 2008.
  - 4,5-Diethyl-10,23-dimethyl-9,24-bis(3-hydroxypropyl)-16,-17-bis(3,hydroxypropyl)oxy-13,20,25,26,27—pentaazapentacyclo-[20.2.1.1^3,6.1^9,11.0^14,19]heptacosa-3,5,8,10,12,14,16,18,20,22,24-undecaene gadolinium hydrates [PDF Version]
    MGd
    Huiming Zhang.
    Created: December 6, 2007; Last Update: January 8, 2008.
  - Anti-c-Met monoclonal antibody linked to biotinylated bovine serum albumin and gadolinium [PDF Version]
    Anti-c-Met-Gd-albumin
    Arvind Chopra.
    Created: December 4, 2008; Last Update: January 7, 2009.
  - Anti-intercellular adhesion molecule 1 antibody–conjugated gadolinium diethylenetriaminepentaacetic acid [PDF Version]
    Gd-DTPA-anti-ICAM-1 antibody
    The MICAD Research Team.
    Created: July 12, 2007; Last Update: August 13, 2007.
  - Anti-malondialdehyde-modified low-density lipoprotein MDA2 monoclonal antibody gadolinium-labeled micelles [PDF Version]
    MDA2 micelles
    Kam Leung.
    Created: August 15, 2009; Last Update: October 22, 2009.
  - Anti-vascular endothelial growth factor polylactic acid-polyethylene glycol-poly-L-Lys/gadolinium-diethylenetriamine pentaacetic acid nanoparticles [PDF Version]
    Anti-VEGF PLA-PEG-PLL-DTPA-Gd NPs
    Kam Leung.
    Created: May 5, 2012; Last Update: July 19, 2012.
  - Avidin-gadolinium [PDF Version]
    Avidin-Gd
    Arvind Chopra.
    Created: December 1, 2008; Last Update: December 26, 2008.
  - Biotinylated bovine serum albumin linked to gadolinium diethylenetriaminepentaacetic acid [PDF Version]
    Biotin-BSA-GdDTPA
    Arvind Chopra.
    Created: December 9, 2008; Last Update: December 26, 2008.
  - Dimeric Gd-tetraazacyclododecanetetraacetic acid-folate [PDF Version]
    P866
    Kam Leung.
    Created: January 17, 2009; Last Update: May 3, 2009.
  - Evans Blue-diethylenetriamine-N,N,N”,N”-pentaacetic acid-gadolinium [PDF Version]
    EB-DTPA-Gd
    Arvind Chopra.
    Created: October 25, 2007; Last Update: December 19, 2007.
  - Folate-polyethylene glycol-ultrasmall superparamagnetic iron oxide nanoparticles [PDF Version]
    P1133
    Kam Leung.
    Created: May 9, 2011; Last Update: July 14, 2011.
  - Gadobenate [PDF Version]
    Gd-BOPTA
    Kenneth T. Cheng.
    Created: November 28, 2005; Last Update: December 3, 2007.
  - Gadobutrol [PDF Version]
    Gd-DO3A-butrol
    Kenneth T. Cheng.
    Created: February 15, 2006; Last Update: October 18, 2007.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-cinnamoyl-Phe-D-Leu-Phe-D-Leu-Phe-Lys-NH₂ [PDF Version]
    Gd-DOTA-cFlFlFK
    Kam Leung.
    Created: May 1, 2013; Last Update: June 6, 2013.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-G3 nanoglobule-CGLIIQKNEC (CLT1) [PDF Version]
    Gd-DOTA-G3-CLT1
    Kam Leung.
    Created: October 1, 2012; Last Update: December 6, 2012.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-Lys-polyethylene glycol-CGLIIQKNEC (CLT1) [PDF Version]
    CLT1-dL-(Gd-DOTA)₄
    Kam Leung.
    Created: September 15, 2012; Last Update: December 6, 2012.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-icosahedral closo-borane₁₂ scaffold conjugated with Glu-{Glu-[cyclo(Arg-Gly-Asp-d-Phe-Lys)]₂}₂ [PDF Version]
    CA-12
    Kam Leung.
    Created: April 11, 2013; Last Update: May 30, 2013.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-N,N’,N’,N’”-tetraacetic-monoamide-24-cascade-polymer [PDF Version]
    24GdDOTACP
    Huiming Zhang.
    Created: October 17, 2007; Last Update: December 4, 2007.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-N',N'',N''',N''''-tetraacetic acid-Gly-Pro-D-Leu-D-Ala-NHOH [PDF Version]
    P947
    Kam Leung.
    Created: December 15, 2008; Last Update: February 24, 2009.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-N',N'',N''',N''''-tetraacetic acid-Pro-Leu-Ala-Leu-Lys-Arg-Asp-Arg [PDF Version]
    Gd-DOTA-PCA7
    Kam Leung.
    Created: June 15, 2008; Last Update: July 15, 2008.
  - Gadolinium 1-((11-S)-3,10-diaza-13-carboxamido-11-carboxy-2,9-dioxotridecyl)-N,N’,N”-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecane [PDF Version]
    Gd-DOTAMA-Gln
    Huiming Zhang.
    Created: November 20, 2007; Last Update: January 3, 2008.
  - Gadolinium-anti-neutrophil gelatinase-associated lipocalin 2 24p3 antibody-conjugated micelles [PDF Version]
    NGAL/24p3-Targeted micelles
    Kam Leung.
    Created: January 15, 2011; Last Update: June 16, 2011.
  - Gadolinium-bis-5-hydroxytriptamide-diethylenetriamine pentaacetic acid [PDF Version]
    Gd-bis-5-HT-DTPA
    Arvind Chopra.
    Created: August 30, 2011; Last Update: October 28, 2011.
  - Gadolinium-diethylenetriamine pentaacetic acid-24-cascade-polymer [PDF Version]
    24GdDTPACP
    Huiming Zhang.
    Created: October 2, 2007; Last Update: December 4, 2007.
  - Gadolinium diethylenetriamine pentaacetic acid-Arg-Gly-Asp peptidomimetic [PDF Version]
    Gd-DTPA-g-mimRGD
    Kam Leung.
    Created: June 15, 2008; Last Update: July 18, 2008.
  - Gadolinium-diethylenetriamine pentaacetic acid-carboxymethylarabinogalactan [PDF Version]
    Gd-DTPA-CMAG-A₂
    Kam Leung.
    Created: November 15, 2008; Last Update: January 6, 2009.
  - Gadolinium-diethylenetriamine pentaacetic acid-GKWHCTTKFPHHYCLY [PDF Version]
    EP-3533
    Kam Leung.
    Created: November 15, 2008; Last Update: January 6, 2009.
  - Gadolinium-Diethylenetriamine pentaacetic acid-Leu-Ile-Lys-Lys-Pro-Phe [PDF Version]
    Gd-DTPA-g-R826
    Kam Leung.
    Created: October 26, 2009; Last Update: March 11, 2010.
  - Gadolinium-Diethylenetriamine pentaacetic acid-poly(lactic-co-glycolic acid) microbubbles [PDF Version]
    Gd-DTPA-PLGA
    Kam Leung.
    Created: October 11, 2010; Last Update: December 9, 2010.
  - Gadolinium-diethylenetriamine tetraacetic acid-icosahedral closo-borane₁₂ scaffold [PDF Version]
    CA-9
    Kam Leung.
    Created: April 11, 2013; Last Update: May 30, 2013.
  - Gadolinium-Hexyl-1,4,7,10-tetraazacyclododecane-1,4,7-triacetic acid-progesterone [PDF Version]
    ProGlo
    Kam Leung.
    Created: May 1, 2012; Last Update: August 9, 2012.
  - Gadolinium-HU-308-incorporated micelles [PDF Version]
    CB2R-Targeted micelles
    Kam Leung.
    Created: March 15, 2011; Last Update: April 21, 2011.
  - Gadolinium-incorporated mesoporous silica nanoparticles [PDF Version]
    Gd₂O₃@SiO₂
    Liang Shan.
    Created: July 11, 2011; Last Update: August 10, 2011.
  - Gadolinium-labeled diethylenetriamine pentaacetic acid-CGLIIQKNEC [PDF Version]
    Gd-DTPA-CLT1
    Kam Leung.
    Created: July 15, 2009; Last Update: September 11, 2009.
  - Gadolinium-reconstituted high-density liproprotein-[palmitoyl-WK(palmitoyl)G(LRKLRKRLLR)₂-NH₂] nanoparticles [PDF Version]
    rHDL-P2A2
    Kam Leung.
    Created: August 15, 2009; Last Update: September 9, 2009.
  - Gadolinium-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-Cys-Asn-Asn-Ser-Lys-Ser-His-Thr-Cys [PDF Version]
    Gd-DOTA-R832
    Kam Leung.
    Created: October 29, 2009; Last Update: March 18, 2010.
  - Gadolinium-tetraazacyclododecane tetraacetic acid coupled with folate via bis(aminoethyl)ethylene glycol linker [PDF Version]
    Gd.DOTA.Folate
    Liang Shan.
    Created: March 12, 2011; Last Update: April 19, 2011.
  - Gadoteridol Gd-HP-DO3A [PDF Version]
    Kenneth T. Cheng.
    Created: October 7, 2005; Last Update: November 5, 2007.
  - GadoversetamideGd-DTPA-BMEA [PDF Version]
    Kenneth T. Cheng.
    Created: November 7, 2007; Last Update: December 10, 2007.
  - Gadoxetate [PDF Version]
    Gd-EOB-DTPA
    Kenneth T. Cheng.
    Created: May 14, 2007; Last Update: April 10, 2008.
  - Gd@C₈₂ Fullerenol [PDF Version]
    Gd@C₈₂(OH)₄₀
    Huiming Zhang.
    Created: October 31, 2008; Last Update: December 1, 2008.
  - Gd-Diethylenetriaminepentaacetic acid-polylysyl-N-glutaryl-phosphatidyl ethanolamine-2C5 liposomes [PDF Version]
    Gd-DTPA-PLL-NGPE-2C5 liposomes
    Kam Leung.
    Created: May 17, 2009; Last Update: June 9, 2009.
  - Gd-DOTA-anti-Aβ42-F(ab’)₂-antibody fragment (putrescine)_n [PDF Version]
    GdAβ42
    Huiming Zhang.
    Created: November 7, 2008; Last Update: December 22, 2008.
  - Gd-DOTA-c(Cys-Arg-Gly-Asp-Cys) [PDF Version]
    P975
    Kam Leung.
    Created: June 27, 2010; Last Update: September 3, 2010.
  - Gd-DOTA-G-NH(CH₂)₁₁CO-RSPAYYTAA-(CH₂CH₂O)₈-R [PDF Version]
    GdPCA2
    Huiming Zhang.
    Created: December 22, 2008; Last Update: January 14, 2009.
  - Gd-DTPA-Bz-poly(α,L-glutamic acid) [PDF Version]
    GdLPG
    Huiming Zhang.
    Created: January 9, 2009; Last Update: January 26, 2009.
  - Gd-DTPA-Cystine diethyl ester copolymers [PDF Version]
    GDCEP
    Kam Leung.
    Created: September 22, 2006; Last Update: November 21, 2007.
  - Gd-DTPA l-Cystine bisamide copolymers [PDF Version]
    GCAC
    Kenneth T. Cheng, Zheng-Rong Lu, and Todd Kaneshiro.
    Created: November 8, 2007; Last Update: January 22, 2008.
  - Gd-DTPA l-Cystine bisisopropyl amide copolymers [PDF Version]
    GCIC
    Kenneth T. Cheng, Zheng-Rong Lu, and Todd Kaneshiro.
    Created: February 7, 2008; Last Update: March 3, 2008.
  - Gd-DTPA l-Cystine bispropyl amide copolymers [PDF Version]
    GCPC
    Kenneth T. Cheng, Zheng-Rong Lu, and Todd Kaneshiro.
    Created: January 30, 2008; Last Update: February 25, 2008.
  - GKVLAK–(Gadolinium-(1,4,7,10-tetraazacyclododecane-1,4,7-tris(acetic acid t-butyl ester)-10-acetic acid monoamide))–GGGGTVQQEL [PDF Version]
    Gd-DCCP16
    Liang Shan.
    Created: March 29, 2011; Last Update: April 26, 2011.
  - Mouse anti-cMet monoclonal antibody linked to gadolinium diethylenetriamine pentaacetic acid conjugated to biotinylated bovine serum albumin [PDF Version]
    Anti-c-Met-Gd-DTPA-albumin
    Arvind Chopra.
    Created: September 15, 2009; Last Update: October 26, 2009.
  - Poly(ethylene glycol)-b-poly(L-lysine)-gadolinium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid micelle [PDF Version]
    PEG-P(Lys-DOTA-Gd)
    Liang Shan.
    Created: May 31, 2011; Last Update: June 23, 2011.
  - Polyion complex micelles of poly(ethylene glycol)-b-poly(L-lysine)-gadolinium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-dextran sulfate [PDF Version]
    PIC micelles
    Liang Shan.
    Created: May 31, 2011; Last Update: June 23, 2011.
  - Pyridine-tetra-acetate-gadolinium(III) (PTA-Gd) conjugated to 17β-estradiol (EPTA-Gd) or tamoxifen (TPTA-Gd) [PDF Version]
    EPTA-Gd; TPTA-Gd
    Arvind Chopra.
    Created: January 23, 2012; Last Update: February 23, 2012.
  - TAMRA-IL-13-Conjugated functionalized gadolinium metallofullerene (Gd₃N@C₈₀(OH)_-26(CH₂CH₂COOH)_-16) [PDF Version]
    TAMRA-IL-13-f-Gd₃N@C₈₀
    Kam Leung.
    Created: September 4, 2011; Last Update: November 17, 2011.
  - Transferrin-coated gadolinium-labeled human serum albumin nanoparticles [PDF Version]
    Gd-HSA-Tf-NP
    Arvind Chopra.
    Created: April 30, 2013; Last Update: May 23, 2013.
  - Tri-gadolinium nitride PEGylated-hydroxylated endohedral metallofullerene [PDF Version]
    Gd₃N@C₈₀[DiPEG₅₀₀₀(OH)_x]
    Huiming Zhang.
    Created: October 28, 2008; Last Update: December 1, 2008.
  - Trisodium-[(2-(R)-[(4,4-diphenylcyclohexyl)phosphono-oxymethyl]-diethylenetriaminepentaacetato)(aquo)gadolinium(III)Gadofosveset [PDF Version]
    Huiming Zhang.
    Created: October 24, 2007; Last Update: January 3, 2008.
- Iron oxide
  - Amine-modified silica-coated polyhedral superparamagnetic iron oxide nanoparticle–labeled rabbit bone marrow–derived mesenchymal stem cells [PDF Version]
    SPIO@SiO₂-NH₂-labeled MSCs
    Liang Shan.
    Created: December 11, 2009; Last Update: January 28, 2010.
  - Anti-ligand–induced binding sites (LIBS) antibody conjugated to microparticles of iron oxide [PDF Version]
    LIBS-MPIOs
    Kam Leung.
    Created: June 21, 2010; Last Update: September 3, 2010.
  - Anti-malondialdehyde-modified low-density lipoprotein MDA2 monoclonal antibody–labeled lipid-coated superparamagnetic iron oxide nanoparticles [PDF Version]
    MDA2 LSPIOs
    Kam Leung.
    Created: May 15, 2012; Last Update: August 2, 2012.
  - Anti-malondialdehyde-modified low-density lipoprotein MDA2 monoclonal antibody–labeled lipid-coated ultra-small superparamagnetic iron oxide nanoparticles [PDF Version]
    MDA2 LUSPIOs
    Kam Leung.
    Created: May 10, 2012; Last Update: August 2, 2012.
  - Anti-vascular cell adhesion molecule antibody M/K-2.7 and anti-P-selectin antibody RB40.34 conjugated microparticles of iron oxide [PDF Version]
    VCAM-MPIO-P-selectin
    Kam Leung.
    Created: March 8, 2008; Last Update: April 21, 2008.
  - Anti-vascular cell adhesion molecule antibody M/K-2.7–conjugated microparticles of iron oxide [PDF Version]
    VCAM-MPIO
    Kam Leung.
    Created: January 28, 2011; Last Update: April 14, 2011.
  - Avidin-coated baculoviral vectors-biotinylated ultra-small superparamagnetic iron oxide nanoparticles [PDF Version]
    Baavi-bUSPIO
    Huiming Zhang.
    Created: March 31, 2008; Last Update: April 30, 2008.
  - Citrate-coated (184^th variant) very small superparamagnetic iron oxide particles [PDF Version]
    VSOP-C184
    The MICAD Research Team.
    Created: September 1, 2006; Last Update: September 27, 2006.
  - CLIO-(H-2K^d)-Lys-Tyr-Asp-Lys-Ala-Asp-Val-Phe-Leu [PDF Version]
    CLIO-NRP-V7
    Huiming Zhang.
    Created: August 15, 2008; Last Update: September 16, 2008.
  - Complement receptor type 2–conjugated superparamagnetic iron oxide nanoparticles [PDF Version]
    CR2-Fc-SPIO
    Kam Leung.
    Created: July 23, 2010; Last Update: December 29, 2010.
  - Cross-linked iron oxide–transactivator transcription [PDF Version]
    CLIO-Tat
    The MICAD Research Team.
    Created: July 18, 2006; Last Update: August 7, 2006.
  - Cyclo(Arg-Gly-Asp-D-Try-Glu) conjugated to ultrasmall superparamagnetic iron oxide nanoparticles [PDF Version]
    c(RGDyE)-USPIO
    Kam Leung.
    Created: February 16, 2008; Last Update: April 30, 2008.
  - Doxorubicin-loaded poly(ethylene oxide)-trimellitic anhydride chloride-folate superparamagnetic iron oxide nanoparticles [PDF Version]
    YCC-DOX
    Arvind Chopra.
    Created: July 16, 2010; Last Update: September 23, 2010.
  - Ferumoxides [PDF Version]
    SSPIO
    Kam Leung.
    Created: November 1, 2004; Last Update: December 12, 2007.
  - Ferumoxsil [PDF Version]
    Large SPIO
    Kam Leung.
    Created: November 1, 2004; Last Update: December 12, 2007.
  - Ferumoxtran [PDF Version]
    USPIO
    Kam Leung.
    Created: November 1, 2004; Last Update: December 12, 2007.
  - FluidMAG iron nanoparticle-labeled mesenchymal stem cells for tracking cell homing to tumors [PDF Version]
    FluidMAG iron nanoparticle-labeled MSCs
    Liang Shan.
    Created: December 23, 2009; Last Update: February 16, 2010.
  - Glycol chitosan/heparin-immobilized gold-deposited iron oxide nanoparticles [PDF Version]
    Composite NPs
    Liang Shan.
    Created: July 28, 2011; Last Update: August 18, 2011.
  - H18/7 F(ab’)₂ E-selectin monoclonal antibody conjugated to cross-linked iron oxide nanoparticles [PDF Version]
    CLIO-H18/7 F(ab’)₂
    Kam Leung.
    Created: March 26, 2007; Last Update: April 20, 2007.
  - Iron oxide–ferritin nanocages [PDF Version]
    Fn-Fe nanocages
    Kam Leung.
    Created: June 4, 2011; Last Update: August 27, 2012.
  - Iron oxide nanoparticles-poly-L-lysine complex [PDF Version]
    SPIO-PLL
    Huiming Zhang.
    Created: February 20, 2008; Last Update: March 26, 2008.
  - Lactoferrin-conjugated poly(ethylene glycol)-coated Fe₃O₄ nanoparticles [PDF Version]
    Fe₃O₄-Lf
    Liang Shan.
    Created: September 25, 2012; Last Update: October 24, 2012.
  - Lactoferrin-conjugated superparamagnetic iron oxide nanoparticles [PDF Version]
    Lf-SPIONs
    Liang Shan.
    Created: September 25, 2012; Last Update: October 24, 2012.
  - Magnetic iron microbeads coupled with HEA-125 monoclonal antibody against epithelial cell adhesion molecule [PDF Version]
    EpCAM microbeads
    Liang Shan.
    Created: February 24, 2011; Last Update: March 29, 2011.
  - MES-1 F(ab’)₂ E-selectin monoclonal antibody conjugated to ultrasmall superparamagnetic iron oxide nanoparticle [PDF Version]
    MES-1-USPIO
    Kam Leung.
    Created: February 8, 2007; Last Update: March 15, 2007.
  - Monoclonal antibody against antigen A7 coupled to ferromagnetic lignosite particles [PDF Version]
    A7-FML
    Arvind Chopra.
    Created: November 20, 2008; Last Update: December 17, 2008.
  - N-Alkyl-polyethylenimine 2 kDa–stabilized superparamagnetic iron oxide nanoparticles for MRI cell tracking [PDF Version]
    Alkyl-PEI2k/SPIO
    Liang Shan.
    Created: January 13, 2011; Last Update: February 22, 2011.
  - Octreotide conjugated to pegylated ultrasmall superparamagnetic iron oxide nanoparticle [PDF Version]
    USPIO-PEG-OCT
    Kam Leung.
    Created: November 5, 2009; Last Update: February 4, 2010.
  - Ovarian cancer antigen 183B2 monoclonal antibody conjugated to ultrasmall superparamagnetic iron oxide nanoparticles [PDF Version]
    OCMab183B2-USPIO
    Kam Leung.
    Created: January 5, 2011; Last Update: April 14, 2011.
  - Poly(N,N-dimethylacrylamide)-coated maghemite nanoparticles for labeling and tracking mesenchymal stem cells [PDF Version]
    PDMAAm-coated γ-Fe₂O₃-labeled MSCs
    Liang Shan.
    Created: December 23, 2009; Last Update: February 16, 2010.
  - Polyethylene glycol–coated and folic acid–conjugated superparamagnetic iron oxide nanoparticles [PDF Version]
    SPIO-PEG-FA
    Liang Shan.
    Created: September 30, 2009; Last Update: November 12, 2009.
  - Saposin C-dioleylphosphatidylserine nanovesicles coupled with iron oxides [PDF Version]
    SapC-DOPS-IO
    Liang Shan.
    Created: June 20, 2011; Last Update: July 18, 2011.
  - Sialy Lewis^x mimetic conjugated to pegylated ultrasmall superparamagnetic iron oxide nanoparticles [PDF Version]
    USPIO-PEG-sLeX
    Kam Leung.
    Created: November 5, 2009; Last Update: February 4, 2010.
  - Sialy Lewis^x mimetic conjugated to ultrasmall superparamagnetic iron oxide nanoparticles [PDF Version]
    USPIO-g-sLeX
    Kam Leung.
    Created: March 5, 2007; Last Update: March 20, 2007.
  - Single-chain anti-epidermal growth factor receptor antibody fragment conjugated to magnetic iron oxide nanoparticles [PDF Version]
    ScFvEGFR-IO
    Arvind Chopra.
    Created: January 26, 2009; Last Update: March 11, 2009.
  - Superparamagnetic iron oxide nanoparticles (SPION) stabilized by alginate [PDF Version]
    SPION-alginate
    Liang Shan.
    Created: October 13, 2009; Last Update: November 30, 2009.
  - Thermally cross-linked superparamagnetic iron oxide nanoparticle-A10 RNA aptamer-doxorubicin conjugate [PDF Version]
    TCL-SPION-Apt(Dox)
    Huiming Zhang.
    Created: August 29, 2008; Last Update: October 8, 2008.
  - Thiol-modified poly(ethylene glycol)-conjugated gold/superparamagnetic iron oxide nanoparticles [PDF Version]
    PEG-S-Au/SPIO
    Kam Leung.
    Created: July 23, 2010; Last Update: December 29, 2010.
  - Trastuzumab-dextran iron oxide nanoparticles [PDF Version]
    Trastuzumab-dextran NP
    Arvind Chopra.
    Created: November 4, 2008; Last Update: December 17, 2008.
  - Trastuzumab-manganese–doped iron oxide nanoparticles [PDF Version]
    Trastuzumab-MnMEIO nanoparticles
    Kam Leung.
    Created: April 19, 2007; Last Update: May 21, 2007.
  - Ultrasmall superparamagnetic iron oxide-anti-CD20 monoclonal antibody [PDF Version]
    USPIO-anti-CD20 MAb
    Kenneth T. Cheng.
    Created: May 21, 2007; Last Update: February 12, 2008.
  - Ultrasmall superparamagnetic iron oxide-cyclo(Cys-Asn-Asn-Ser-Lys-Ser-His-Thr-Cys) [PDF Version]
    USPIO-R832
    Kam Leung.
    Created: March 3, 2013; Last Update: May 9, 2013.
  - Ultrasmall superparamagnetic iron oxide-Leu-Ile-Lys-Lys-Pro-Phe [PDF Version]
    USPIO-R826
    Kam Leung.
    Created: February 26, 2013; Last Update: May 16, 2013.
  - Ultrasmall superparamagnetic iron oxide nanoparticles conjugated with Ile-Pro-Leu-Pro-Phe-Tyr-Asn [PDF Version]
    USPIO-PHO
    Kam Leung.
    Created: February 23, 2010; Last Update: March 25, 2010.
  - Z_HER2:342 Affibody-polyethylene glycol-superparamagnetic iron oxide nanoparticles [PDF Version]
    IO-PEG-Z_HER2:342
    Kam Leung.
    Created: July 16, 2012; Last Update: October 18, 2012.
- Manganese ferrite
  - Anti-malondialdehyde-modified low-density lipoprotein MDA2 murine monoclonal antibody manganese-micelles [PDF Version]
    MDA2-Mn micelles
    Kam Leung.
    Created: May 10, 2012; Last Update: August 27, 2012.
  - Manganese(II)-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-G3 nanoglobule-CGLIIQKNEC (CLT1) [PDF Version]
    Mn-DOTA-G3-CLT1
    Kam Leung.
    Created: September 15, 2012; Last Update: December 6, 2012.
  - Vascular endothelial growth factor A isoform 121-gelonin fusion protein–conjugated manganese ferrite nanoparticles [PDF Version]
    VEGF₁₂₁/rGel-MNPs
    Liang Shan.
    Created: July 6, 2011; Last Update: August 17, 2011.
- Nitroxide
  - ¹⁵N-Labeled 4-oxo-2,2,6,6-tetramethyl-piperidine-1-oxyl [PDF Version]
    [¹⁵N]TEMPONE
    Huiming Zhang.
    Created: April 30, 2008; Last Update: June 9, 2008.
  - 3-Carbamoyl-2,2,5,5-tetramethyl-1-pyrrolidinyl-N-oxyl [PDF Version]
    3CP
    Huiming Zhang.
    Created: April 30, 2008; Last Update: June 9, 2008.
  - 3-Carboxy-2,2,5,5-tetramethyl-pyrrolidinyl-N-oxyl [PDF Version]
    3CxP
    Huiming Zhang.
    Created: April 30, 2008; Last Update: June 9, 2008.
- Nitroxide
  - ¹⁷O-Labeled water [PDF Version]
    H₂¹⁷O
    Kam Leung.
    Created: May 27, 2010; Last Update: August 5, 2010.
  - ¹⁷O-Oxygen [PDF Version]
    ¹⁷O₂
    Kam Leung.
    Created: May 17, 2010; Last Update: August 5, 2010.
- Tm3+
  - Tm-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-acetamidoacetic acid [PDF Version]
    Tm-DOTA-Gly
    Mark Pagel and Kam Leung.
    Created: February 19, 2009; Last Update: March 10, 2009.
- Yb
  - Ytterbium chelated to 1,4,7,10-tetraazacyclododecane-1,4,7-triacetic acid,10-orthoaminoanilide [PDF Version]
    Yb-DO3A-oAA
    Mark Pagel and Arvind Chopra.
    Created: November 26, 2011; Last Update: January 5, 2012.
Multimodal
- 111In, 68Ga
  - ¹¹¹In/⁶⁸Ga-Labeled anti-epidermal growth factor receptor, native chemical ligation cyclized Affibody Z_HER2:342min [PDF Version]
    [¹¹¹In/⁶⁸Ga]Z_HER2:342min
    Arvind Chopra.
    Created: April 3, 2013; Last Update: May 23, 2013.
  - ¹¹¹In/⁶⁸Ga-Labeled DOTA-conjugated cyclo[γ-d-Glu-Ala-Tyr-d-Lys]-Trp-Met-Asp-Phe-NH₂ (cyclo-MG1), a minigastrin analog [PDF Version]
    [¹¹¹In/⁶⁸Ga]-DOTA-cyclo-MG1
    Arvind Chopra.
    Created: May 17, 2012; Last Update: July 12, 2012.
  - ¹¹¹In/⁶⁸Ga-Labeled DOTA conjugated cyclo[γ-d-Glu-Ala-Tyr-d-Lys]-Trp-Nle-Asp-Phe-NH₂ (cyclo-MG2), a minigastrin analog [PDF Version]
    [¹¹¹In/⁶⁸Ga]-DOTA-cyclo-MG2
    Arvind Chopra.
    Created: May 17, 2012; Last Update: July 26, 2012.
- 111In, Cy5.5
  - ¹¹¹In-Labeled multifunctional single-attachment-point reagent-c[RGDfK] [PDF Version]
    ¹¹¹In-MSAP-RGD
    Liang Shan.
    Created: July 13, 2012; Last Update: August 21, 2012.
- 111In, Cy7
  - ¹¹¹In-Labeled annexin A5-polyethylene glycol–coated core-cross-linked polymeric micelle-Cy7 [PDF Version]
    ¹¹¹In-A5-CCPM
    Kam Leung.
    Created: November 30, 2011; Last Update: January 19, 2012.
  - ¹¹¹In-Labeled-TNYLFSPNGPIARAW (TNYL-RAW)-polyethylene glycol–coated core-cross-linked polymeric micelle-Cy7 [PDF Version]
    ¹¹¹In-TNYL-RAW-CCPM
    Kam Leung.
    Created: September 18, 2011; Last Update: January 19, 2012.
- 111In, CyAL5.5
  - ¹¹¹In-Labeled Ac-TZ14011 peptide (a chemokine receptor 4 antagonist) conjugated to CyAL5.5 (a fluorescent dye) through a multifunctional single-attachment point (MSAP) reagent [PDF Version]
    [¹¹¹In]Ac-TZ14011-MSAP
    Arvind Chopra.
    Created: November 29, 2012; Last Update: December 27, 2012.
- 111In and IRDye800
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-benzyl-succinamido-Lys-IRDye800-c(Arg-Gly-Asp-D-Phe-Lys) [PDF Version]
    ¹¹¹In-DTPA-Bz-SA-Lys-IRDye800-c(RGDfK)
    Kam Leung.
    Created: October 4, 2008; Last Update: November 17, 2008.
- 111In and IRDye 800CW
  - ¹¹¹In-(Diethylenetriamine pentaacetic acid)_n-trastuzumab-(IRDye 800CW)_m [PDF Version]
    ¹¹¹In-(DTPA)_n-trastuzumab-(IRDye 800CW)_m
    Arvind Chopra.
    Created: January 5, 2009; Last Update: April 5, 2009.
- 123I, 124I
  - Radioiodinated T84.66 minibody [PDF Version]
    ^123/124I-T84.66 minibody
    Kam Leung.
    Created: February 2, 2008; Last Update: April 3, 2008.
- 124I, 125I
  - ¹²⁴I/¹²⁵I-Fibril-reactive monoclonal antibody [PDF Version]
    ¹²⁴I/¹²⁵I-11-1F4 MAb
    Kenneth T. Cheng.
    Created: December 7, 2006; Last Update: January 2, 2008.
- 177Lu, cypate
  - ¹⁷⁷Lu-DOTA-Tyr³-c(Cys-Tyr-Trp-Lys-Thr-Cys)-Thr-Lys(cypate)-NH₂ [PDF Version]
    ¹⁷⁷Lu-LS172
    Huiming Zhang.
    Created: March 20, 2008; Last Update: April 22, 2008.
- 64Cu, Cy5.5
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-Lys(Cy5.5)-Gly-Gly-Tyr-knottin 2.5D [PDF Version]
    ⁶⁴Cu-DOTA/Cy5.5-2.5D
    Kam Leung.
    Created: September 28, 2010; Last Update: January 7, 2011.
  - BBQ650-Pro-Leu-Gly-Val-Arg-Lys(Cy5.5)-Glu-Lys(⁶⁴Cu-DOTA)-OH [PDF Version]
    BBQ650-PLGVR-K(Cy5.5)-E-K(⁶⁴Cu-DOTA)-OH
    Kam Leung.
    Created: January 6, 2013; Last Update: April 11, 2013.
  - Cys-Asp-Cys-Arg-Gly-Asp-Cys-Phe-Cys/Cy5.5-Ferritin ⁶⁴Cu-loaded nanocages [PDF Version]
    RGD4C/Cy5.5-Fn-⁶⁴Cu nanocages
    Kam Leung.
    Created: June 23, 2011; Last Update: September 15, 2011.
- 64Cu, cypate
  - ⁶⁴Cu-DOTA-Tyr³-c(Cys-Tyr-Trp-Lys-Thr-Cys)-Thr-Lys(cypate)-NH₂ [PDF Version]
    ⁶⁴Cu-LS172
    Huiming Zhang.
    Created: March 20, 2008; Last Update: April 21, 2008.
- 64Cu, quantum dot (QD705)
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-quantum dot-vascular endothelial growth factor [PDF Version]
    ⁶⁴Cu-DOTA-QD-VEGF
    Huiming Zhang.
    Created: July 1, 2008; Last Update: August 12, 2008.
- 64Cu and Acridine
  - ⁶⁴Cu-Labeled 2,6-bis(dimethylamino)-10-(4-((4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclodo-decan-1-yl)methyl)benzyl)-acridin-10-ium [PDF Version]
    [⁶⁴Cu]DO3A-xy-ACR
    Arvind Chopra.
    Created: February 26, 2013; Last Update: April 11, 2013.
- 64Cu and IRDye800
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4,7-triacetic acid-p-isothiocyanatobenzyl-bevacizumab-IRDye 800CW [PDF Version]
    ⁶⁴Cu-NOTA-Bev-800CW
    Kam Leung.
    Created: December 7, 2012; Last Update: March 21, 2013.
  - ⁶⁴Cu-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (DOTA)-conjugated IRDye 800CW (a near-infrared fluorescence dye) coupled to mAb7, an anti-epithelial cell adhesion molecule monoclonal antibody [PDF Version]
    [⁶⁴Cu]DOTA-IRDye 800CW-mAb7
    Arvind Chopra.
    Created: March 5, 2013; Last Update: April 11, 2013.
  - ⁶⁴Cu-Labeled NOTA-conjugated anti-CD105 (endoglin) chimeric monoclonal antibody linked to near-infrared dye IRDye 800CW [PDF Version]
    [⁶⁴Cu]-NOTA-TRC105-800CW
    Arvind Chopra.
    Created: March 23, 2012; Last Update: May 10, 2012.
- 64Cu and LRhodamine
  - ⁶⁴Cu-Labeled DOTA-Lissamine Rhodamine B and derivatives [PDF Version]
    [⁶⁴Cu]DOTA-LRB
    Arvind Chopra.
    Created: January 16, 2013; Last Update: January 31, 2013.
- 64Cu and quantum dot
  - ⁶⁴Cu-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-quantum dot-c(Arg-Gly-Asp-D-Tyr-Lys) [PDF Version]
    ⁶⁴Cu-DOTA-QD-c(RGDyK)
    Kam Leung.
    Created: March 1, 2008; Last Update: May 21, 2008.
- 66/67/68Ga
  - ^66/67/68Ga-γ-Deferoxamine-folate [PDF Version]
    ^66/67/68Ga-γ-DF-folate
    Kam Leung.
    Created: September 14, 2006; Last Update: January 30, 2011.
- 67Ga, 68Ga
  - [NIe⁴,Asp⁵,d-Phe⁷, ⁶⁷Ga/⁶⁸Ga-1,4,7,10-tetraazacyclododecane-N,N’,N’’,N’’’-1,4,7,10-tetraacetic acid-Lys¹¹]-α-MSH_4-11 [PDF Version]
    ⁶⁷Ga/⁶⁸Ga-DOTA-NAPamide
    Kenneth T. Cheng.
    Created: July 30, 2007; Last Update: November 19, 2007.
- 89Zr and IRDye 800CW
  - ⁸⁹Zr-Labeled anti-CD105 (endoglin) chimeric monoclonal antibody TRC105 linked to IRDye 800CW [PDF Version]
    [⁸⁹Zr]TRC105-IRDye800CW
    Arvind Chopra.
    Created: January 23, 2013; Last Update: January 31, 2013.
- 99mTc, iodine
  - ^99mTc-Labeled acetylated, 2,3,5-triiodobenzoic acid- and diethylenetriamine pentaacetic acid-conjugated, and PEGylated ethylenediamine-core generation 4 polyamidoamine dendrimers [PDF Version]
    ^99mTc-G4-[[[[Ac]-TIBA]-DTPA]-mPEG₁₂]
    Liang Shan.
    Created: March 5, 2012; Last Update: April 25, 2012.
- Alexa Fluor 680, gadolinium
  - Alexa Fluor 680-labeled transferrin-cationic (NBD-labeled DOPE-DOTAP) liposome-encapsulated gadopentetate dimeglumine complex [PDF Version]
    Tf^NIR-Lip^NBD-CA complex
    Kenneth T. Cheng, Paul C. Wang, and Liang Shan.
    Created: October 18, 2007; Last Update: December 17, 2007.
- Au, gadolinium (Gd)
  - Gold nanoparticles coated with dithiolated diethylenetriamine pentaacetic acid-gadolinium chelate [PDF Version]
    Au@DTDTPA-Gd₅₀
    Liang Shan.
    Created: September 24, 2010; Last Update: November 17, 2010.
  - Gold nanoparticles functionalized with gadolinium-diethylenetriamine pentaacetic acid-cysteine conjugate [PDF Version]
    Au@GdL
    Liang Shan.
    Created: September 24, 2010; Last Update: November 17, 2010.
- Cy5.5, gadolinium (Gd)
  - Annexin A5-Gd-micelles-Cy5.5 [PDF Version]
    AnxA5-micelles
    Kam Leung.
    Created: February 27, 2011; Last Update: April 27, 2011.
  - Cy5.5-Labeled and gadolinium-chelated chitosan nanoparticles [PDF Version]
    Cy5.5-CNP-Gd(III)
    Liang Shan.
    Created: September 2, 2010; Last Update: October 20, 2010.
  - Gadolinium-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid monoamide-G2 nanoglobule-CGLIIQKNEC (CLT1)-Cy5 [PDF Version]
    CLT1-G2-(Gd-DOTA-MA)-Cy5
    Kam Leung.
    Created: April 21, 2013; Last Update: June 13, 2013.
  - Gadolinium-G6 dendrimer-Cy5.5 [PDF Version]
    Gd-G6-Cy5.5
    Kam Leung.
    Created: June 19, 2009; Last Update: July 23, 2009.
- Cy5.5, gadolinium (Gd), gold (Au)
  - Gold/silica nanoparticles with a near-infrared fluorescent and PEGylated paramagnetic lipid coating [PDF Version]
    Au-SiFluPaLCs
    Liang Shan.
    Created: May 23, 2011; Last Update: June 23, 2011.
- Europium, perfluorocarbon
  - Eu-chelate anti-fibrin antibody-conjugated perfluorocarbon nanoparticles [PDF Version]
    EuPFC
    Huiming Zhang.
    Created: January 17, 2008; Last Update: February 20, 2008.
- Gadolinium, Texas Red
  - Anti-ICAM-1 antibody-conjugated paramagnetic liposomes [PDF Version]
    Anti-ICAM ACPLs
    Huiming Zhang.
    Created: January 3, 2008; Last Update: February 14, 2008.
- Gadolinium (Gd3+), quantum dots (QDs)
  - Gadolinium-diethylenetriaminepentaacetic acid-cyclo(Cys-Asn-Gly-Arg-Cys)-Gly-Lys-quantum dots [PDF Version]
    cNGR-pQDs
    Kam Leung.
    Created: January 15, 2009; Last Update: March 19, 2009.
  - PEGylated paramagnetic lipid-coated silica nanoparticles with a fluorescent quantum dot core [PDF Version]
    Q-SiPaLCs
    Liang Shan.
    Created: May 23, 2011; Last Update: June 23, 2011.
- Gold nanoparticles, Cy5.5
  - Cy5.5-Containing matrix metalloproteinase (MMP) activatable peptide conjugated to glycol chitosan (GC)–coated gold nanoparticles (AuNPs) [PDF Version]
    MMP-GC-AuNPs
    Arvind Chopra.
    Created: March 6, 2012; Last Update: April 12, 2012.
- I (as iohexol); Gd (as gadoteridol)
  - PEGylated liposome co-encapsulating iohexol and gadoteridol for multimodal CT and MR imaging [PDF Version]
    PEGlipo-IG-1
    Jinzi Zheng, Christine Allen, David Jaffray, and Arvind Chopra.
    Created: July 29, 2011; Last Update: September 29, 2011.
- IR-783 and 111In
  - ¹¹¹In-DTPA-Bz-NH-SA-K(IR-783-S-Ph-CO)-c(CGRRAGGSC)NH₂ [PDF Version]
    ¹¹¹In-DLIA-IL11Rα
    Kam Leung.
    Created: September 2, 2007; Last Update: November 6, 2007.
- Iron, GFP
  - Bimodal lentiviral vector encoding myc-tagged human ferritin heavy chain and green fluorescent protein (GFP) [PDF Version]
    Lenti-myc-hFTH
    Liang Shan.
    Created: February 2, 2011; Last Update: March 9, 2011.
- Iron oxide, 111In
  - ¹¹¹In-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-benzyl-ChL6-superparamagnetic iron oxide nanoparticles [PDF Version]
    ¹¹¹In-DOTA-Bz-ChL6-SPIO
    Kam Leung.
    Created: August 8, 2008; Last Update: September 3, 2008.
- Iron oxide, 124I
  - ¹²⁴I-Serum albumin-manganese-magnetism-engineered iron oxide nanoparticles [PDF Version]
    ¹²⁴I-SA-MnMEIO
    Kam Leung.
    Created: February 1, 2009; Last Update: May 3, 2009.
- Iron oxide, Cy5.5
  - Annexin V-cross-linked iron oxide-Cy5.5 [PDF Version]
    AnxCLIO-Cy5.5
    Kam Leung.
    Created: July 27, 2006; Last Update: March 28, 2008.
  - Anti-vascular cell adhesion molecule monoclonal antibody M/K-2.7 conjugated cross-linked iron oxide-Cy5.5 nanoparticles [PDF Version]
    VCAM-NP
    Kam Leung.
    Created: October 1, 2007; Last Update: October 29, 2007.
  - Cross-linked iron oxide-Cy5.5 [PDF Version]
    CLIO-Cy5.5
    The MICAD Research Team.
    Created: July 5, 2006; Last Update: July 21, 2006.
  - Cy5.5-Amino-terminal fragment of urokinase-type plasminogen activator conjugated to magnetic iron oxide nanoparticles [PDF Version]
    Cy5.5-AFT-IO
    Kam Leung.
    Created: October 7, 2009; Last Update: December 24, 2009.
  - Cy5.5-Arg-Arg-Arg-Arg-crosslinked iron oxide nanoparticle [PDF Version]
    Cy5.5-R4-SC-CLIO
    Kam Leung.
    Created: May 16, 2005; Last Update: June 2, 2005.
  - Gly-Ser-Ser-Lys-(FITC)-Gly-Gly-Gly-Cys-Arg-Gly-Asp-Cys-CLIO-Cy5.5 [PDF Version]
    cRGD-CLIO(Cy5.5)
    Huiming Zhang.
    Created: December 17, 2007; Last Update: January 18, 2008.
  - Green fluorescent protein specified small interfering RNA-cross-linked iron oxide nanoparticles-Cy5.5 [PDF Version]
    siGFP-CLIO-Cy5.5
    Huiming Zhang.
    Created: April 17, 2008; Last Update: May 12, 2008.
  - IPLVVPLGGSC(Cy5.5-Cross-linked iron oxide)K(Fitc) [PDF Version]
    IPL-NP
    Kam Leung.
    Created: August 10, 2008; Last Update: September 16, 2008.
  - Lys-Thr-Leu-Leu-Pro-Thr-Pro-cross-linked iron oxide-Cy5.5 [PDF Version]
    PTP-CLIO-Cy5.5
    Kam Leung.
    Created: August 8, 2008; Last Update: February 22, 2011.
  - Survivin specified small interfering RNA-CLIO-Cy5.5 [PDF Version]
    siSurvivin-CLIO-Cy5.5
    Huiming Zhang.
    Created: April 17, 2008; Last Update: May 12, 2008.
  - VCAM-1 internalizing peptide-28 nanoparticles [PDF Version]
    VINP-28 NP
    Kam Leung.
    Created: September 29, 2007; Last Update: December 4, 2007.
- Iron oxide, Cy5.5, FITC
  - Bombesin peptide conjugated–cross-linked iron oxide-Cy5.5 [PDF Version]
    BN-CLIO-Cy5.5
    The MICAD Research Team.
    Created: August 1, 2006; Last Update: August 17, 2006.
  - Cross-linked iron oxide–C-AHA-AREPPTRTFAYWGK(FITC) [PDF Version]
    CLIO-EPPT
    The MICAD Research Team.
    Created: July 26, 2006; Last Update: August 14, 2006.
- Iron oxide, Cy7
  - Cys-Arg-Glu-Lys-Ala-superparamagnetic iron oxide-Cy7 nanoparticles [PDF Version]
    CREKA-SPIO-Cy7
    Kam Leung.
    Created: August 8, 2008; Last Update: October 15, 2008.
- Iron oxides, RITC
  - Multimodal, rhodamine B isothiocyanate-incorporated, silica-coated magnetic nanoparticle–labeled human cord blood–derived mesenchymal stem cells for cell tracking [PDF Version]
    MNPs@SiO₂(RITC)-labeled MSCs
    Liang Shan.
    Created: December 11, 2009; Last Update: January 28, 2010.
- Iron oxides, VT680, 64Cu
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-iron oxide-c(RGDyK) nanoparticles [PDF Version]
    ⁶⁴Cu-DOTA-IO-RGDyK
    Kam Leung.
    Created: October 1, 2009; Last Update: December 3, 2009.
  - ⁶⁴Cu-DTPA-CLIO-VT680 [PDF Version]
    ⁶⁴Cu-TNP
    Huiming Zhang.
    Created: February 8, 2008; Last Update: March 11, 2008.
- Microspheres, 166Ho
  - [¹⁶⁶Ho]-Loaded poly(L-lactic acid) microspheres [PDF Version]
    [¹⁶⁶Ho]-PLLA-MS
    Arvind Chopra.
    Created: August 19, 2010; Last Update: October 14, 2010.
- Quantum dot, gadolinium
  - Annexin A5-quantum dot-DTPA-gadolinium [PDF Version]
    AnxA5-QD-Gd
    Kam Leung.
    Created: March 16, 2007; Last Update: March 27, 2008.
Optical
- 5-Carboxy-fluorescein
  - 5-Carboxy-fluorescein-labeled octreotate [PDF Version]
    OcF
    Liang Shan.
    Created: July 27, 2010; Last Update: August 16, 2010.
- A15
  - A15 (NIRF agent) [PDF Version]
    The MICAD Research Team.
    Created: May 4, 2006; Last Update: May 30, 2006.
- Alexa Fluor 488
  - AlexaFluor 488-conjugated antibody against lymphatic vessel endothelial hyaluronan receptor-1 (LYVE-1) [PDF Version]
    Alexa488-Anti-LYVE-1
    Kam Leung.
    Created: March 24, 2011; Last Update: July 6, 2011.
  - Alexa Fluor 488–conjugated anti-carcinoembryonic antigen monoclonal antibody [PDF Version]
    Alexa Fluor 488 anti-CEA MAb
    Arvind Chopra.
    Created: August 11, 2008; Last Update: September 2, 2008.
- Alexa Fluor 647
  - Ac-rkkrrorrrGK(QSY21)DEVDAPC(Alexa Fluor 647)-NH₂ [PDF Version]
    T_CAPQ₆₄₇
    Kenneth T. Cheng and David Piwnica-Worms.
    Created: January 23, 2008; Last Update: April 22, 2008.
- Alexa Fluor 680
  - Alexa 680 conjugated to bovine serum albumin [PDF Version]
    Alexa680-BSA
    Arvind Chopra.
    Created: March 8, 2012; Last Update: March 29, 2012.
  - Alexa Fluor 680-Bevacizumab [PDF Version]
    Alexa680-Bevacizumab
    Kam Leung.
    Created: October 17, 2008; Last Update: December 16, 2008.
  - Alexa Fluor 680-glycylglycylglycine-bombesin[7-14]NH₂ peptide [PDF Version]
    Alexa Fluor 680-G-G-G-BN[7-14]NH₂
    Kenneth T. Cheng, Charles J. Smith, Lixin Ma, Ping Yu, and Timothy J. Hoffman.
    Created: July 20, 2007; Last Update: August 25, 2007.
  - Alexa Fluor 680-NH-CO-CH₂-S-CH₂-Phe-Pro-Arg-CH₂-prothrombin [PDF Version]
    AF680-ProT
    Liang Shan.
    Created: March 15, 2012; Last Update: May 15, 2012.
  - Humanized anti–type 1 insulin-like growth factor receptor monoclonal antibody conjugated to Alexa 680 [PDF Version]
    AVE1642-Alexa 680
    Arvind Chopra.
    Created: July 13, 2009; Last Update: August 4, 2009.
  - LLP2A-biotin-streptavidin-Alexa Fluor 680 [PDF Version]
    LLP2A-SA-Alexa680
    Kam Leung.
    Created: October 10, 2007; Last Update: December 4, 2007.
  - Self-quenching Alexa fluor 680 conjugated to trastuzumab [PDF Version]
    Tra-Alexa680(SQ)
    Arvind Chopra.
    Created: March 5, 2009; Last Update: April 6, 2009.
- Alexa Fluor 700
  - AlexaFluor 700–Labeled regioselectively addressable functionalized template-[cyclo-(Arg-Gly-Asp-d-Phe-Lys)]₄ [PDF Version]
    A700-RAFT-RGD
    Liang Shan.
    Created: July 17, 2012; Last Update: August 29, 2012.
- Alexa Fluor 750
  - Alexa Fluor 750-albumin-binding domain-fused-(Z_HER2:342)₂ Affibody [PDF Version]
    Alexa750-ABD-fused-(Z_HER2:342)₂ Affibody
    Kam Leung.
    Created: December 16, 2008; Last Update: April 4, 2011.
  - Alexa Fluor 750-Z_HER2:342 Affibody [PDF Version]
    Alexa750-Z_HER2:342
    Kam Leung.
    Created: June 16, 2010; Last Update: March 16, 2011.
- AOI987
  - AOI987 [PDF Version]
    The MICAD Research Team.
    Created: May 17, 2006; Last Update: June 15, 2006.
- Au
  - Gold-polyethylene glycol nanoshells [PDF Version]
    Au-PEG-nanoshells
    Kam Leung.
    Created: May 26, 2008; Last Update: June 9, 2008.
  - Polyethylene glycol–coated gold nanoshells conjugated with anti-VCAM-1 antibody [PDF Version]
    Kam Leung.
    Created: February 28, 2013; Last Update: May 16, 2013.
  - Ultrasmall near-infrared gold nanoclusters [PDF Version]
    AuNCs
    Kam Leung.
    Created: March 19, 2011; Last Update: June 2, 2011.
- BODIPY-FL
  - BODIPY-FL-neutravidin-biotin-Cetuximab [PDF Version]
    BODIPY-FL-Cetuximab
    Kam Leung.
    Created: January 15, 2008; Last Update: February 25, 2008.
- BODIPY TMR-X
  - Carbobenzoxy-capped Phe-Lys(BODIPY TMR-X-acyloxymethyl ketone(QSY7) [PDF Version]
    GB117
    Liang Shan.
    Created: May 19, 2010; Last Update: May 25, 2010.
- CellVue Maroon
  - CellVue Maroon–labeled saposin C-dioleylphosphatidylserine nanovesicles [PDF Version]
    CVM-SapC-DOPS
    Liang Shan.
    Created: June 20, 2011; Last Update: July 18, 2011.
- Cy5
  - Carbobenzoxy-capped Phe-Lys(Cy5)-acyloxymethyl ketone [PDF Version]
    GB123
    Liang Shan.
    Created: May 9, 2010; Last Update: May 25, 2010.
  - Cbz-Phe-Lys(Cy5)-methyl ketone-2,6,dimethylterephthalic amide-hexyl-QSY 21 [PDF Version]
    GB137
    Huiming Zhang.
    Created: November 24, 2008; Last Update: January 5, 2009.
  - Cy5-Glu-Pro-Asp-acyloxymethyl ketone [PDF Version]
    Cy5-AB50
    Kam Leung.
    Created: November 8, 2009; Last Update: December 30, 2009.
  - Cy5-labeled aza-peptidyl Pro-Asn epoxide [PDF Version]
    LP-1
    Liang Shan.
    Created: May 12, 2010; Last Update: June 3, 2010.
  - Cy5-Regioselectively addressable functionalized template-[cyclo-(RGD-d-Phe-Lys)]₄ peptide [PDF Version]
    Cy5-RAFT-c(-RGDfK-)₄
    Kenneth T. Cheng, Elisabeth Garanger, Veronique Josserand, Zhaohui Jin, Stephanie Foillard, Didier Boturyn, Pr Marie C. Favrot, Pascal Dumy, and Jean-Luc Coll.
    Created: October 9, 2007; Last Update: December 28, 2007.
  - Cy5-Tat-Glu-Pro-Asp-acyloxymethyl ketone [PDF Version]
    tAB50-Cy5
    Liang Shan.
    Created: May 19, 2010; Last Update: June 3, 2010.
  - L36-Cy5 anti-laminin trimerbody [PDF Version]
    L36-Cy5 anti-laminin trimerbody
    Liang Shan.
    Created: June 11, 2009; Last Update: August 18, 2009.
  - MFE23-Cy5 anti-carcinoembryonic antigen trimerbody [PDF Version]
    MFE23-Cy5 anti-CEA trimerbody
    Liang Shan.
    Created: June 11, 2009; Last Update: August 18, 2009.
  - Recombinant human erythropoietin coupled to near-infrared fluorescence dye Cy5.5 [PDF Version]
    Epo-Cy5.5
    Arvind Chopra.
    Created: February 2, 2012; Last Update: February 23, 2012.
  - Self-quenched-regioselectively addressable functionalized template-[cyclo-(RGD-d-Phe-Lys)]₄ peptide-Cy5-fluorescence quencher QSY21 [PDF Version]
    RAFT-c(-RGDfK-)₄-Cy5-SS-Q
    Kenneth T. Cheng, Jesus Razkin, Veronique Josserand, Zhaohui Jin, Stephanie Foillard, Didier Boturyn, Pr Marie C. Favrot, Pascal Dumy, and Jean-Luc Coll.
    Created: October 31, 2007; Last Update: January 21, 2008.
- Cy5.5
  - 2-(1E,3E,5E)-5-3-(R)-1-(1-(R)-2-(R)-2-[2-(4-(Benzo[d]thiazol-2-ylamino)phenyl)\acetamido]-6-(E)-3-(pyridin-3-yl)acrylamido)hexanamido)-5-carboxypentanamido)cyclohexyl)-27-carbamoyl-1,9,13,21,25,33-hexaoxo-5,17-dioxa-2,8,14,20,26,32-hexa-azaheptatriacontan-37-yl)-1,1-dimethyl-6,8-disulfonato-1H-benzo[e]indol-2(3H)-ylid-ene)penta-1,3-dienyl)-3-ethyl-1,1-dimethyl-1H-ben-zo[e]indolium-6,8-disulfonate [PDF Version]
    Cy5.5-LLP2A-6
    Kam Leung.
    Created: June 10, 2009; Last Update: August 12, 2009.
  - Chlorotoxin:Cy5.5 [PDF Version]
    CTX:Cy5.5
    The MICAD Research Team.
    Created: July 23, 2007; Last Update: August 30, 2007.
  - Cy5.5-3-Benzo[1,3]dioxol-5-yl-5-hydroxy-5-(4-methoxyphenyl)-4-(3,4,5-trimethoxybenzyl)-5H-furan-2-one) [PDF Version]
    Cy5.5-PD156707
    Kam Leung.
    Created: August 12, 2009; Last Update: September 30, 2009.
  - Cy5.5-8-Amino-octanoic acid-Ser-Cys-Pro-Pro-Trp-Gln-Glu-Trp-His-Asn-Phe-Met-Pro-Phe-NH₂ [PDF Version]
    Cy5.5-Aoc-EGBP
    Kam Leung.
    Created: August 21, 2012; Last Update: November 15, 2012.
  - Cy5.5-Ac-Cys-Z_EGFR:1907 [PDF Version]
    Cy5.5-Z_EGFR:1907
    Kam Leung.
    Created: June 21, 2012; Last Update: September 7, 2012.
  - Cy5.5-Aminohexanoic acid-RPLALWRS-aminohexanoic acid-C-G4-PAMAM-PEG-AF750 [PDF Version]
    PB-M7NIR
    Kam Leung.
    Created: April 26, 2009; Last Update: May 28, 2009.
  - Cy5.5-Annexin V [PDF Version]
    The MICAD Research Team.
    Created: September 28, 2005; Last Update: October 31, 2005.
  - Cy5.5-Anti-ephrin receptor B4 (EphB4) humanized monoclonal antibody hAb47 [PDF Version]
    Cy5.5-hAb47
    Kam Leung.
    Created: March 18, 2013; Last Update: May 9, 2013.
  - Cy5.5-Asp-Gly-Glu-Ala (DGEA) [PDF Version]
    Cy5.5-DGEA
    Kam Leung.
    Created: January 3, 2012; Last Update: April 5, 2012.
  - Cy5.5-Asp-Gly-Glu-Ala-Gly-Lys-(Arg)₈-OH [PDF Version]
    Cy5.5-DGEAGK(R8)-OH
    Kam Leung.
    Created: January 6, 2012; Last Update: April 5, 2012.
  - Cy5.5-c(Lys-Ala-His-Trp-Gly-Phe-Thr-Leu-Asp)NH₂ [PDF Version]
    Cy5.5-C6
    Kam Leung.
    Created: March 20, 2010; Last Update: April 15, 2010.
  - Cy5.5-CGRRRQRRKKRG-Labeled T lymphocytes [PDF Version]
    Cy5.5-Tat-T cells
    Huiming Zhang.
    Created: July 10, 2008; Last Update: August 27, 2008.
  - Cy5.5-Chitosan-anti-vascular endothelial growth factor receptor 2 monoclonal antibody DC101 [PDF Version]
    Cy5.5-Chitosan-DC101
    Kam Leung.
    Created: September 15, 2011; Last Update: December 15, 2011.
  - Cy5.5 conjugated anti-epidermal growth factor receptor monoclonal antibody [PDF Version]
    Cetuximab-Cy5.5
    Arvind Chopra.
    Created: October 18, 2007; Last Update: November 1, 2007.
  - Cy5.5-Conjugated anti-epidermal growth factor receptor monoclonal antibody C225 [PDF Version]
    C225-Cy5.5
    Arvind Chopra.
    Created: April 14, 2009; Last Update: July 22, 2009.
  - Cy5.5-Conjugated anti-human CD31 monoclonal antibody [PDF Version]
    Cy5.5-anti-hCD31 MAb
    Arvind Chopra.
    Created: December 15, 2008; Last Update: January 7, 2009.
  - Cy5.5-Conjugated glycol chitosan-5β-cholanic acid nanoparticles [PDF Version]
    Cy5.5-CNPs
    Arvind Chopra.
    Created: March 12, 2012; Last Update: May 10, 2012.
  - Cy5.5-Conjugated matrix metalloproteinase cleavable peptide nanoprobe [PDF Version]
    Cy5.5-MMP probe
    Arvind Chopra.
    Created: March 19, 2012; Last Update: April 12, 2012.
  - Cy5.5-Cyclo(CGNSNPKSC) [PDF Version]
    Cy5.5-GX1
    Kam Leung.
    Created: January 30, 2012; Last Update: May 3, 2012.
  - Cy5.5-Endostatin [PDF Version]
    Kam Leung.
    Created: May 8, 2006; Last Update: February 27, 2012.
  - Cy5.5-Epidermal growth factor [PDF Version]
    Cy5.5-EGF
    Kam Leung.
    Created: July 15, 2006; Last Update: March 27, 2012.
  - Cy5.5-Ferritin nanocages [PDF Version]
    Cy5.5-Fn nanocages
    Kam Leung.
    Created: June 4, 2011; Last Update: August 18, 2011.
  - Cy5.5-GGPRQITAGK(Fitc)C-Poly-L-lysine-methoxypolyethylene glycol [PDF Version]
    Cy5.5-GGPRQITAGK(Fitc)C-PL-MPEG
    Kam Leung.
    Created: October 10, 2007.
  - Cy5.5-GGSGRSANAK(Fitc)C-poly-L-lysine-methoxy polyethylene glycol [PDF Version]
    Cy5.5-GGSGRSANAK(Fitc)C-PL-MPEG
    Kam Leung.
    Created: January 5, 2009; Last Update: March 3, 2009.
  - Cy5.5-Gly-His-Pro-Gly-Gly-Pro-Gln-Gly-Lys(Fitc)-Cys-Poly-L-lysine-methoxypolyethylene glycol [PDF Version]
    Cy5.5-GHPGGPQK(Fitc)C-PL-MPEG
    Kam Leung.
    Created: January 2, 2008; Last Update: January 22, 2008.
  - Cy5.5-Gly-Pro-Leu-Gly-Val-Arg-Gly-(TDOPA)₃-flower-like gold–Fe₃O₄ optical nanoparticles [PDF Version]
    FANPs
    Kam Leung.
    Created: October 6, 2011; Last Update: January 5, 2012.
  - Cy5.5-Gly-Pro-Leu-Gly-Val-Arg-Gly-Cys-Ferritin-black hole quencher-3 nanocages [PDF Version]
    C/B-Fn nanocages
    Kam Leung.
    Created: June 21, 2011; Last Update: September 15, 2011.
  - Cy5.5-Gly-Pro-Leu-Gly-Val-Arg-Gly-Cys-gold nanoparticles [PDF Version]
    Cy5.5-MMP-AuNPs
    Kam Leung.
    Created: April 26, 2009; Last Update: May 28, 2009.
  - Cy5.5-Human serum albumin-tissue inhibitor of matrix metalloproteinase 2 fusion protein [PDF Version]
    Cy5.5-HSA/TIMP-2
    Kam Leung.
    Created: February 4, 2012; Last Update: May 31, 2012.
  - Cy5.5-Knottin 2.5D [PDF Version]
    Cy5.5-Knottin 2.5D
    Arvind Chopra.
    Created: March 26, 2009; Last Update: May 28, 2009.
  - Cy5.5-Knottin 2.5F [PDF Version]
    Cy5.5-Knottin 2.5F
    Arvind Chopra.
    Created: March 26, 2009; Last Update: May 28, 2009.
  - Cy5.5-labeled pH low insertion peptide (pHLIP) [PDF Version]
    pHLIP-Cy5.5
    Liang Shan.
    Created: August 8, 2009; Last Update: November 12, 2009.
  - Cy5.5-Polyethylene glycol-CGS25966 inhibitor of matrix metalloproteinases [PDF Version]
    Cy5.5-AF489
    Kam Leung.
    Created: February 14, 2013; Last Update: May 9, 2013.
  - Cy5.5-Poly-L-lysine-methoxypolyethylene glycol [PDF Version]
    Cy5.5-PL-MPEG
    Kam Leung.
    Created: November 10, 2007.
  - Cy5.5-Rituximab [PDF Version]
    Cy5.5-RIT
    Kam Leung.
    Created: March 10, 2009; Last Update: June 4, 2009.
  - Cy5.5-Single-chain Cys-tagged vascular endothelial growth factor-121 [PDF Version]
    Cy5.5-scVEGF₁₂₁
    Kam Leung.
    Created: February 17, 2008; Last Update: March 31, 2008.
  - Cy5.5-Trastuzumab [PDF Version]
    Cy5.5-Trast
    Kam Leung.
    Created: June 15, 2006; Last Update: March 28, 2012.
  - Cyclo(Arg-Gly-Asp-d-Tyr-Lys)-Cy5.5 [PDF Version]
    RGD-Cy5.5
    Kam Leung.
    Created: December 27, 2004; Last Update: September 22, 2011.
  - Cyclo(Cys-Arg-Gly-Asp-Cys)-Gly-Lys-Cy5.5 [PDF Version]
    c(CRGDC)-GK-Cy5.5
    Kam Leung.
    Created: October 17, 2011; Last Update: February 2, 2012.
  - Cyclo(Cys-Asn-Gly-Arg-Cys)-Gly-Lys-Cy5.5 [PDF Version]
    Cy5.5-cNGR
    Kam Leung.
    Created: January 15, 2009; Last Update: March 19, 2009.
  - Cys-Arg-Lys-Arg-Leu-Asp-Arg-Asn-Cys-glycol chitosan-Cy5.5 nanoparticles [PDF Version]
    AP-HGC-Cy5.5 NPs
    Kam Leung.
    Created: April 15, 2009; Last Update: July 7, 2009.
  - D-Cys-D-Asp-Gly-HCit-Gly-Pro-Gln-D-Cys-Ebes-Ebes-Lys-Cy5.5 [PDF Version]
    OA02-Cy5.5
    Kam Leung.
    Created: September 6, 2007; Last Update: October 18, 2007.
  - D-Cys-D-Asp-Gly-HCit-Gly-Pro-Gln-D-Cys-Ebes-Lys-polyethylene glycol-cholic acids-Cy5.5 telodendrimer nanoparticles [PDF Version]
    OA02-PEG^5k-CA_8-Cy5.5 NPs
    Kam Leung.
    Created: June 1, 2012; Last Update: September 7, 2012.
  - D-Cys-D-Asp-Gly-Leu-Gly-ProOH-Asn-D-Cys-biotin-streptavidin-Cy5.5 [PDF Version]
    LXY1-biotin-SA-Cy5.5
    Kam Leung.
    Created: May 6, 2009; Last Update: June 6, 2009.
  - D-Cys-D-Asp-Gly-Tyr(3-NO₂)-Gly-ProOH-Asn-D-Cys-biotin-streptavidin-Cy5.5 [PDF Version]
    LXY2-biotin-SA-Cy5.5
    Kam Leung.
    Created: May 6, 2009; Last Update: June 8, 2009.
  - Fibroblast activation protein α–specific, near-infrared peptide probe (KGPGPNQC) linked to Cy5.5 and a quencher dye, QSY21 [PDF Version]
    ANP_FAP
    Arvind Chopra.
    Created: October 31, 2012; Last Update: November 21, 2012.
  - Mesenchymal-epithelial transition factor binding peptide-8-aminooctanoic acid conjugated to Cy5.5 [PDF Version]
    cMBP-AOC-Cy5.5
    Arvind Chopra.
    Created: July 30, 2009; Last Update: September 10, 2009.
  - Mesenchymal-epithelial transition factor binding peptide-Gly-Gly-Gly conjugated to Cy5.5 [PDF Version]
    cMBP-GGG-Cy5.5
    Arvind Chopra.
    Created: July 31, 2009; Last Update: September 10, 2009.
  - Sialyl-Lewis^x-liposome-Cy5.5 [PDF Version]
    SLX-Lipo-Cy5.5
    Kam Leung.
    Created: April 28, 2009; Last Update: June 5, 2009.
- Cy7
  - Cy7-(3S,7S)-26-Amino-5,13,20-trioxo-4,6,12,21-tetraazahexacosane-1,3,7,22-tetracarboxylic acid [PDF Version]
    Cy7-3
    Kam Leung.
    Created: December 27, 2012; Last Update: April 4, 2013.
  - Cy7-Bis-dipicolylamine-zinc [PDF Version]
    Cy7-DPA-Zn
    Kam Leung.
    Created: October 8, 2008; Last Update: November 12, 2008.
  - Cy7-Polyethylene glycol-cinnamoyl-Phe-D-Leu-Phe-D-Leu-Phe-Lys-NH₂ [PDF Version]
    Cy7-PEG-cFlFlFK
    Kam Leung.
    Created: May 1, 2013; Last Update: June 13, 2013.
  - Cy7-Tetrameric arginine-glycine-aspartic acid peptide [PDF Version]
    Cy7-E{E[c(RGDyK)]₂}₂
    Kenneth T. Cheng.
    Created: March 9, 2007; Last Update: May 13, 2008.
  - Cy7-Tyr-d-Glu-Cys-Hyp-Tyr(3-Cl)-Gly-Leu-Cys-Tyr-Ile-Gln-NH₂ [PDF Version]
    Cy7-FTP11
    Kam Leung.
    Created: April 27, 2013; Last Update: May 30, 2013.
- Cypate
  - Cypate-2-Deoxy-d-glucose [PDF Version]
    Cypate-2DG
    Kam Leung.
    Created: August 18, 2012; Last Update: November 15, 2012.
  - cypate-d: -(+)-glucosamine (cyp-GlcN), and d: -(+)-glucosamine-cypate-d: -(+)-glucosamine (cyp-2GlcN) [PDF Version]
    cyp-GlcN and cyp-2GlcN
    Arvind Chopra.
    Created: August 8, 2012; Last Update: September 13, 2012.
  - Cypate-Gly-Arg-Asp-Ser-Pro-Lys [PDF Version]
    Cyp-GRDSPK
    Kam Leung.
    Created: September 26, 2005; Last Update: October 12, 2005.
- DiD
  - DiD-Labeled anti-EpCAM-directed NK-92-scFv(MOC31) zeta cells [PDF Version]
    DiD-NK-92-scFv(MOC31) zeta cells
    Kam Leung.
    Created: August 28, 2009; Last Update: September 30, 2009.
- DiR
  - Indotricarbocyanine-loaded AS1411 DNA aptamer- and TGN peptide-modified poly(ethylene glycol)-poly(ε-caprolactone) nanoparticles [PDF Version]
    DiR-AsTNP
    Liang Shan.
    Created: August 10, 2012; Last Update: September 5, 2012.
  - Near-infrared fluorescence 1,1-dioctadecyl-3,3,3,3-tetramethylindotricarbocyanine iodide (DiR)-labeled macrophages for cell imaging [PDF Version]
    DiR-Labeled macrophages
    Liang Shan.
    Created: December 11, 2009; Last Update: January 12, 2010.
- DY675
  - DY-675-g7-Poly(lactic-co-glycolic acid) nanoparticles [PDF Version]
    DY-g7-PLGA NPs
    Kam Leung.
    Created: December 1, 2010; Last Update: March 3, 2011.
- DY682
  - DY-682-Albumin-binding domain-fused-Z_HER2:342 Affibody [PDF Version]
    DY-682-ABD-Z_HER2:342
    Kam Leung.
    Created: June 17, 2010.
- DY750
  - DyLight 750-MES-1 E-selectin monoclonal antibody [PDF Version]
    DyLight 750-MES-1
    Kam Leung.
    Created: February 28, 2011; Last Update: June 1, 2011.
- Fluorescein
  - Fluorescein-conjugated human serum albumin [PDF Version]
    FLS-HSA
    The MICAD Research Team.
    Created: July 26, 2007; Last Update: August 30, 2007.
- Fluorescein isothiocyanate (FITC)
  - 4-[2-(3,4,5,6-Tetrahydropyrimidin-2-ylamino)ethyloxy]benzoyl-2-(S)-[N-3-amino-neopenta-1-carbamyl)]-aminoethylsulfonylamino-β-alanine fluorescein thiourea [PDF Version]
    FITC-IAC
    Kenneth T. Cheng, Narasimhan Danthi, and Jianwu Xie.
    Created: October 9, 2007; Last Update: January 2, 2008.
  - Fluorescein-conjugated cyclic decapeptides, CGLIIQKNEC (CLT1) and CNAGESSKNC (CLT2) [PDF Version]
    Fluorescent CLT peptides
    Liang Shan.
    Created: July 28, 2011; Last Revision: August 28, 2012.
- Green fluorescence protein
  - Recombinant adenovirus with enhanced green fluorescent protein [PDF Version]
    Ad-E3-EGFP
    Arvind Chopra.
    Created: December 9, 2007; Last Update: January 2, 2008.
- Green fluorescence protein (GFP), luciferin
  - HSV1-TK/GFP/Fluc [PDF Version]
    TGL
    Huiming Zhang.
    Created: October 21, 2008; Last Update: December 1, 2008.
- HiLyte Fluor 647
  - HiLyte Fluor 647-hyaluronic acid-gold nanoparticles [PDF Version]
    HHAuNPs
    Kam Leung.
    Created: December 26, 2008; Last Update: February 24, 2009.
- IANBD
  - Annexin B12 Cys101,Cys260-N,N'-dimethyl-N-(iodoacetyl)-N'-(7-nitrobenz-2-oxa-1,3-diazol-4-yl)ethylenediamine [PDF Version]
    pSIVA_m
    Liang Shan.
    Created: May 22, 2010; Last Update: June 30, 2010.
- Indocyanine green
  - Anti-human sperm protein 17 monoclonal antibody-indocyanine green derivative 02 [PDF Version]
    Anti-Sp17-ICG-Der-02
    Kam Leung.
    Created: September 8, 2012; Last Update: December 20, 2012.
  - Bovine serum albumin–stabilized gold nanoclusters conjugated with folate and indocyanine green derivative 02 [PDF Version]
    Au-FA-MPA
    Kam Leung.
    Created: October 4, 2012; Last Update: January 24, 2013.
  - Bovine serum albumin–stabilized gold nanoclusters conjugated with l-methionine and indocyanine green derivative 02 [PDF Version]
    Au-Met-MPA
    Kam Leung.
    Created: October 1, 2012; Last Update: January 24, 2013.
  - Daclizumab complexed to near-infrared fluorophore indocyanine green [PDF Version]
    Dac-ICG
    Arvind Chopra.
    Created: February 17, 2009; Last Update: March 4, 2009.
  - Folic acid-indocyanine green-poly(d,l-lactide-coglycolide)-lipid nanoparticles [PDF Version]
    FA-ICG-PLGA-lipid NPs
    Arvind Chopra.
    Created: August 30, 2012; Last Update: September 27, 2012.
  - Indocyanine green derivative 02-2-deoxy-d-glucose [PDF Version]
    ICG-Der-02-2DG
    Kam Leung.
    Created: September 17, 2012; Last Update: December 20, 2012.
  - Indocyanine green derivative 02-Glu-c(RGDyK)₂ [PDF Version]
    ICG-Der-02-c(RGDyK)₂
    Kam Leung.
    Created: September 24, 2012; Last Update: December 28, 2012.
  - Indocyanine green–doped calcium phosphate nanoparticles [PDF Version]
    ICG-CPNPs
    Kam Leung.
    Created: March 17, 2010; Last Update: April 15, 2010.
  - Indocyanine green-polyethylene glycol-folate [PDF Version]
    fPI-01
    Kam Leung.
    Created: January 19, 2011; Last Update: April 20, 2011.
  - l-Methyl-methionine-indocyanine green derivative 02 [PDF Version]
    Met-ICG-Der-02
    Kam Leung.
    Created: September 27, 2012; Last Update: December 28, 2012.
  - Quenched indocyanine green-anti-prostate-specific membrane antigen antibody J591 [PDF Version]
    ICG-J591
    Kam Leung.
    Created: December 8, 2011; Last Update: March 1, 2012.
  - Trastuzumab complexed to near-infrared fluorophore indocyanine green [PDF Version]
    Tra-ICG
    Arvind Chopra.
    Created: February 11, 2009; Last Update: March 4, 2009.
- Indocyanine green and Alexa Fluor680
  - Activatable Alexa Fluor680-conjugated panitumumab and indocyanine green-conjugated trastuzumab cocktail [PDF Version]
    Pan-Alexa680 and Tra-ICG cocktail
    Liang Shan.
    Created: May 16, 2012; Last Update: July 10, 2012.
- IR-783
  - 2-[2-[2-Chloro-3-[2-[1,3-dihydro-3,3-dimethyl-1-(4-sulfobutyl)-2H-indol-2-ylidene]-ethylidene]-1-cyclohexen-1-yl]-ethenyl]-3,3-dimethyl-1-(4-sulfobutyl)-3H-indolium [PDF Version]
    IR-783
    Kam Leung.
    Created: July 12, 2010; Last Update: October 20, 2010.
  - Hyaluronan conjugated with IR-783 [PDF Version]
    IR783-HA
    Kam Leung.
    Created: May 24, 2011; Last Update: July 21, 2011.
  - IR-783-Glucosamine [PDF Version]
    IR-2
    Kam Leung.
    Created: August 2, 2008; Last Update: May 11, 2009.
- IR-786
  - Hoechst 33258-polyethylene glycol-IR-786 [PDF Version]
    Hoechst-IR
    Kam Leung.
    Created: September 29, 2011; Last Update: December 29, 2011.
  - IR-786 perchlorate [PDF Version]
    IR-786
    Kam Leung.
    Created: January 3, 2005; Last Update: October 5, 2011.
- IR-820
  - Protoporphyrin IX and IR-820 fluorophore–encapsulated organically modified silica nanoparticles [PDF Version]
    PpIX/IR-820–doped ORMOSIL NPs
    Liang Shan.
    Created: June 29, 2012; Last Update: August 7, 2012.
- IR-820 and FITC
  - N'-Fluorescein-N''-[4-O-(β-d-glucopyranuronic acid)-3-difluoromethylphenyl]-S-methylthiourea (FITC-TrapG) and N'-(p-aminophenyl)thioether of IR-820-N''-[4-O-(β-d-glucopyranuronic acid)-3-difluoromethylphenyl]-S-methylthiourea (NIR-TrapG) [PDF Version]
    FITC-TrapG and NIR-TrapG
    Arvind Chopra.
    Created: April 10, 2012; Last Update: May 10, 2012.
- IRDye700DX
  - IRDye 700DX-Labeled annexin V [PDF Version]
    NIR700-Annexin V
    Arvind Chopra.
    Created: October 27, 2009; Last Update: December 17, 2009.
- IRDye78
  - GPI-78 [PDF Version]
    Kam Leung.
    Created: May 5, 2006; Last Update: August 12, 2008.
  - Pamidronate-IRDye78 [PDF Version]
    PAM78
    Kam Leung.
    Created: January 4, 2005; Last Update: January 5, 2012.
- IRDye 800CW
  - Biotinylated vascular endothelial growth factor₁₂₁-Avi-streptavidin-IRDye800 [PDF Version]
    VEGF₁₂₁-Avib-SA800
    Kam Leung.
    Created: May 17, 2009; Last Update: July 7, 2009.
  - Humanized anti-CD44v6 monoclonal antibody labeled with IRDye800CW [PDF Version]
    Anti-CD44v6-IRDye800CW
    Arvind Chopra.
    Created: May 20, 2013; Last Update: June 28, 2013.
  - IRDye800-2-(3-{5-[7-(5-amino-1-carboxy-pentylcarbamoyl)-heptanoylamino]-1-carboxy-pentyl}-ureido)-pentanedioic acid [PDF Version]
    YC-27
    Kam Leung.
    Created: May 12, 2010; Last Update: July 7, 2010.
  - IRDye800-2-Deoxy-D-glucose [PDF Version]
    IRDye800-2-DG
    Kam Leung.
    Created: May 17, 2009; Last Update: July 24, 2009.
  - IRDye 800-albumin-binding domain-fused-Z_HER2:342 Affibody [PDF Version]
    IRDye 800-ABD-Z_HER2:342
    Kam Leung.
    Created: March 16, 2011; Last Update: March 6, 2013.
  - IRDye 800-Anti–epidermal growth factor receptor Affibody [PDF Version]
    Eaff800
    Kam Leung.
    Created: June 17, 2010; Last Update: September 9, 2010.
  - IRDye800-Anti-vascular endothelial growth factor receptor-2 monoclonal antibody Avas12a1 [PDF Version]
    IRDye800-Avas12a1
    Kam Leung.
    Created: February 17, 2010; Last Update: April 1, 2010.
  - IRDye800CW-anti-CD105 TRC105 chimeric monoclonal antibody [PDF Version]
    IRDye800CW-TRC105
    Kam Leung.
    Created: December 1, 2011; Last Update: February 22, 2012.
  - IRDye 800CW-Anti-epidermal growth factor receptor nanobody 7D12 [PDF Version]
    IRDye800CW-7D12
    Kam Leung.
    Created: April 6, 2012; Last Update: July 12, 2012.
  - IRDye800CW-Cyclic albumin-binding domain (Ac-RLIEDICLPRWGCLWEDDK-NH₂) [PDF Version]
    IRDye800-cABD
    Kam Leung.
    Created: December 19, 2011; Last Update: March 1, 2012.
  - IRDye 800CW-Epidermal growth factor [PDF Version]
    IRDye 800CW-EGF
    Kam Leung.
    Created: January 19, 2007; Last Update: June 21, 2010.
  - IRDye 800CW-Human serum albumin [PDF Version]
    HSA800
    Kam Leung.
    Created: January 19, 2007; Last Update: May 17, 2012.
  - Near-infrared Dye^®800CW–conjugated disulfide-based cyclic RGD peptide c(CRGDKGPDC) and its DOTA analog [PDF Version]
    Ac-Cys(IRDye800CW)-iRGD and DOTA-Cys(IRDye800CW)-iRGD
    Arvind Chopra.
    Created: August 6, 2012; Last Update: August 30, 2012.
  - Near-infrared dye IRDye 800CW-labeled butyrylcholinesterase [PDF Version]
    BChE-IRDye 800CW
    Liang Shan.
    Created: October 20, 2009; Last Update: December 14, 2009.
- IRIS Blue
  - GKVLAK–(IRIS Blue-(1,4,7,10-tetraazacyclododecane-1,4,7-tris(acetic acid t-butyl ester)-10-acetic acid monoamide))–GGGGTVQQEL [PDF Version]
    DCCP16-IRIS Blue
    Liang Shan.
    Created: March 29, 2011; Last Update: April 26, 2011.
- Luciferin
  - Ad5-(PSE-BC)-(GAL4-(VP16)₂)-(GAL4)₅-Fluc [PDF Version]
    AdTSTA-FL
    Huiming Zhang.
    Created: December 5, 2008; Last Update: January 5, 2009.
  - Gaussia princeps luciferase [PDF Version]
    hGLuc
    Arvind Chopra.
    Created: January 31, 2008; Last Update: February 28, 2008.
  - Id protein-firefly luciferase N-fragment & firefly luciferase C-fragment-MyoD protein [PDF Version]
    Id-NFluc & CFluc-MyoD
    Huiming Zhang.
    Created: September 24, 2008; Last Update: October 23, 2008.
  - Luciferase-expressing Escherichia coli [PDF Version]
    pLux-expressing E. coli
    Arvind Chopra.
    Created: January 22, 2008; Last Update: February 5, 2008.
  - NFluc-FHA2-Aktpep-CFluc [PDF Version]
    BARNCFluc
    Huiming Zhang.
    Created: November 14, 2008; Last Update: December 22, 2008.
  - NRluc-hER_281-549-CRluc [PDF Version]
    hERNCRluc
    Huiming Zhang.
    Created: December 29, 2008; Last Update: January 26, 2009.
  - T84.66 Anti-CEA diabody-GSTSGSGKPGSGEGSTSG-Renilla luciferase [PDF Version]
    Db-18-Rluc8
    Huiming Zhang.
    Created: September 18, 2008; Last Update: October 23, 2008.
- Malachite green
  - Malachite green-isothiocyanate-polyethylene glycol-gold nanoparticles conjugated with scFv anti-EGFR B10 antibody [PDF Version]
    MGITC-AuNPs-scFvB10
    Kam Leung.
    Created: February 26, 2008; Last Update: May 14, 2008.
- NIAD-4
  - [[5'-(4-Hydroxyphenyl)[2,2’-bithiophen]-5-yl]methylene]-propanedinitrile NIAD-4 [PDF Version]
    Kenneth T. Cheng.
    Created: September 11, 2006; Last Update: November 8, 2007.
- NIR2
  - LTVSPWY peptide–modified PEGylated chitosan magnetic nanoparticles [PDF Version]
    LTVSPWY-PEG-CS NPs
    Arvind Chopra.
    Created: September 7, 2012; Last Update: October 11, 2012.
  - NIR2-Folate [PDF Version]
    Kam Leung.
    Created: May 19, 2006; Last Update: May 30, 2006.
  - Pegylated bis(4-(N-(2-naphthyl)phenylamino)phenyl)-fumaronitrile (NPAPF) nanoparticles [PDF Version]
    NPAPF-PEG NPs
    Arvind Chopra.
    Created: August 22, 2012; Last Update: September 27, 2012.
- Oregon Green 488
  - Cetuximab-Oregon Green 488 [PDF Version]
    Cetuximab-OG
    The MICAD Research Team.
    Created: August 22, 2007; Last Update: September 24, 2007.
  - Collagen-binding adhesion protein 35-Oregon Green 488 [PDF Version]
    CNA35-OG488
    Kenneth T. Cheng and Marc A.M.J. Van Zandvoort.
    Created: December 11, 2007; Last Update: January 28, 2008.
  - OG488-Cyclo(Cys-Asn-Gly-Arg-Cys)-Gly-Lys [PDF Version]
    OG488-cNGR
    Kam Leung.
    Created: January 15, 2009; Last Update: March 19, 2009.
- Pyropheophorbide α (Pyro)
  - Pyro-Gly-Asp-Glu-Val-Asp-Gly-Ser-Gly-Lys(BHQ3) [PDF Version]
    PPB
    Huiming Zhang.
    Created: May 22, 2008; Last Update: July 21, 2008.
  - Pyro-Gly-Pro-Leu-Gly-Leu-Ala-Arg-Lys(BHQ3) [PDF Version]
    PP_MMP7B
    Huiming Zhang.
    Created: May 22, 2008; Last Update: July 21, 2008.
- Quantum dot (QD)
  - Anti-α-Fetoprotein antibody-quantum dots [PDF Version]
    Anti-AFP-QDs
    Kam Leung.
    Created: February 6, 2009; Last Update: February 24, 2009.
  - Arginine-glycine-aspartic acid peptide-labeled quantum dot 705 [PDF Version]
    QD705-RGD
    Kenneth T. Cheng.
    Created: May 1, 2006; Last Update: May 8, 2008.
  - Epidermal growth factor conjugated to near-infrared fluorescent quantum dots [PDF Version]
    EGF-QD
    Arvind Chopra.
    Created: February 2, 2009; Last Update: February 25, 2009.
  - Humanized anti–type 1 insulin-like growth factor receptor monoclonal antibody conjugated to cadmium telluride quantum dots [PDF Version]
    AVE1642-QD
    Arvind Chopra.
    Created: July 15, 2009; Last Update: August 12, 2009.
  - Ligand-conjugated, gold-doped CdHgTe quantum dots for multispectral imaging [PDF Version]
    QD800-RGD, QD820-anti-CEACAM1, and QD840-anti-EGFR
    Liang Shan.
    Created: October 23, 2012; Last Update: November 7, 2012.
  - QD800-Anti-epidermal growth factor receptor monoclonal antibody nanoparticles [PDF Version]
    QD800-EGFR Ab
    Kam Leung.
    Created: January 6, 2013; Last Update: April 4, 2013.
  - QD800-Polyethylene glycol-Cys-Z_HER2:342 Affibody [PDF Version]
    QD800-PEG-Z_HER2:342
    Kam Leung.
    Created: July 20, 2012; Last Update: October 18, 2012.
  - Quantum dot 800-conjugated anti-Tn IgM 2154F12A4 murine monoclonal antibody [PDF Version]
    Qdot 800-anti-Tn 2154F12A4 mAb
    Liang Shan.
    Created: August 21, 2009; Last Update: October 28, 2009.
  - Quantum dot 800–mercaptopropionic acid [PDF Version]
    QD800-MPA
    Kam Leung.
    Created: February 28, 2011; Last Update: May 28, 2011.
  - Quantum dot800-poly(ethylene glycol)-c(Arg-Gly-Asp-d-Tyr-Lys) [PDF Version]
    QD800-PEG-c(RGDyK)
    Kam Leung.
    Created: March 21, 2011; Last Update: June 16, 2011.
  - Quantum dot 800–prostate-specific membrane antigen antibody J591 [PDF Version]
    QD800-J591
    Kam Leung.
    Created: February 28, 2011; Last Update: May 18, 2011.
  - Quantum dot-A10 RNA aptamer-doxorubicin conjugate [PDF Version]
    QD-Apt(Dox)
    Huiming Zhang.
    Created: August 25, 2008; Last Update: October 8, 2008.
  - Quantum dot-prostate-specific membrane antigen antibody J591 [PDF Version]
    QD655-J591
    Kam Leung.
    Created: September 30, 2005; Last Update: February 14, 2011.
  - Quantum dots-deoxycholic acid (DOCA)-conjugated low molecular weight heparin (LMWH) nanoparticles [PDF Version]
    Q-LHD
    Kam Leung.
    Created: November 28, 2012; Last Update: February 28, 2013.
  - Quantum dot-trastuzumab [PDF Version]
    QT
    Kam Leung.
    Created: March 1, 2007; Last Update: February 24, 2011.
  - Single-chain anti-epidermal growth factor receptor antibody fragment conjugated to functionalized quantum dots [PDF Version]
    ScFvEGFR-QD
    Arvind Chopra.
    Created: January 22, 2009; Last Update: March 11, 2009.
- Rhodamine green (RhodG)
  - Galactosyl serum albumin-rhodamine green [PDF Version]
    GSA-RhodG
    Kam Leung.
    Created: November 26, 2007; Last Update: January 15, 2008.
  - Trastuzumab-rhodamine green [PDF Version]
    Trast-RhodG
    Kam Leung.
    Created: January 19, 2008; Last Update: February 25, 2008.
- RhodamineX
  - Galactosamine-serum albumin-rhodamineX₂₀ [PDF Version]
    GmSA-20ROX
    Kam Leung.
    Created: December 10, 2007; Last Update: January 18, 2008.
- SIDAG
  - 1,1’-bis-(4-sulfobutyl)indotricarbocyanine-5,5’-dicarboxylic acid diglucamide monosodium salt [PDF Version]
    SIDAG
    The MICAD Research Team.
    Created: June 1, 2006; Last Update: June 18, 2006.
- Single-walled carbon nanotubes (SWNTs)
  - Cyclic Arg-Gly-Asp-polyethyleneglycol-single-walled carbon nanotubes [PDF Version]
    RGD-PEG-SWNTs
    Huiming Zhang.
    Created: October 6, 2008; Last Update: November 17, 2008.
- Tetramethyl-6-carboxyrhodamine
  - Avidin conjugated to tetramethyl-6-carboxyrhodamine-QSY^®7 [PDF Version]
    Av-TM-Q7
    Arvind Chopra.
    Created: February 20, 2009; Last Update: April 6, 2009.
  - Trastuzumab conjugated to tetramethyl-6-carboxyrhodamine-QSY^®7 [PDF Version]
    Traz-TM-Q7
    Arvind Chopra.
    Created: March 2, 2009; Last Update: April 6, 2009.
- Tetramethylrhodamine
  - Polyethylene glycol-Cys-Arg-Ser-Gly-Pro-Leu-Gly-Val-Tyr-Lys-Lys-tetramethylrhodamine [PDF Version]
    PEG-peptide-TMR
    Kam Leung.
    Created: February 6, 2012; Last Update: May 10, 2012.
- THK-265
  - 5-(2E,4E)-5-(6-hydroxy-4-oxo-2-thioxo-1,2,3,4-tetrahydroxy-5 pyrimidinyl)-2,4-pentadienylidene-2-thioxodihydro-4,6(1H,5H)-pyrimidinedione [PDF Version]
    THK-265
    Kam Leung.
    Created: July 1, 2012; Last Update: October 25, 2012.
- TOTO-3
  - Quinolinium, 1,1'-[1,3-propanediylbis[(dimethyliminio)-3,1-propanediyl]]bis[4-[3-(3-methyl-2(3H)-benzothiazolylidene)-1-propen-1-yl]-,iodide (1:4) [PDF Version]
    TOTO-3
    Liang Shan.
    Created: April 2, 2012; Last Update: May 2, 2012.
- VivoTag 750
  - VivoTag-S 750-(S)-2-amino-4-pentynoic acid¹²-exendin-4 [PDF Version]
    E4_X12-VT750
    Kam Leung.
    Created: November 1, 2011; Last Update: January 5, 2012.
- VivoTag-S680
  - VivoTag-S 680-anti-human mammaglobin-A monoclonal antibody [PDF Version]
    MamAb-680
    Kam Leung.
    Created: May 19, 2011; Last Update: July 21, 2011.
  - VivoTag-S680–conjugated 3-aminomethyl α_vβ₃ antagonist derivative for fluorescence molecular tomography of tumors [PDF Version]
    IntegriSense
    Liang Shan.
    Created: January 6, 2010; Last Update: May 19, 2010.
- VM315
  - 3,3-Diphenylpropylamido-indocyanine sulfonamide [PDF Version]
    VM315
    Milind Rajopadhye.
    Created: December 13, 2006; Last Update: January 26, 2007.
- ZW800-1
  - ZW800-1, a zwitterionic near-infrared fluorophore, and its cyclic RGD peptide derivative cyclo-(RGDyK)-ZW800-1 [PDF Version]
    ZW800-1 and cRGD-ZW800-1
    Arvind Chopra.
    Created: February 12, 2013; Last Update: February 28, 2013.
PET
- 11C
  - (-)-3-(4-Chlorophenyl)-N'-[(4-[¹¹C]cyanophenyl)sulfonyl]-4-phenyl-4,5-dihydro-1H-pyrazole-1-carboxamidine [PDF Version]
    [¹¹C]CB1-(-)-12a
    Kam Leung.
    Created: December 16, 2008; Last Update: January 2, 2009.
  - (-)-4-[¹¹C]Methoxycarbonyl-2-[(1-pyrrolidinylmethyl]-1-[(3,4-dichlorophenyl)acetyl]-piperidine [PDF Version]
    [¹¹C]GR103545
    Kam Leung.
    Created: May 21, 2006; Last Update: March 21, 2012.
  - (-)-N-[¹¹C]Propyl-norapomorphine [PDF Version]
    [¹¹C]NPA
    Kam Leung.
    Created: April 6, 2006; Last Update: June 30, 2011.
  - (+/-)-2-(N-Cyclohexylethyl-N-[¹¹C]propyl)amino-5-hydroxytetralin [PDF Version]
    [¹¹C]ZYY-339
    Kam Leung.
    Created: August 16, 2006; Last Update: February 4, 2008.
  - (+/-)-2-(N-Phenethyl-N-1'-[¹¹C]propyl)amino-5-hydroxytetralin [PDF Version]
    [¹¹C]PPHT
    Kam Leung.
    Created: August 16, 2006; Last Update: February 4, 2008.
  - (+)-(2S,3S)-3-(2-[¹¹C]Methoxybenzylamino)-2-phenylpiperidine [PDF Version]
    [¹¹C]CP-99,994
    Kenneth T. Cheng.
    Created: November 14, 2006; Last Update: January 23, 2008.
  - (+)-8-Chloro-5-(7-benzofuranyl)-7-hydroxy-3-[¹¹C]methyl-2,3,4,5-tetrahydro-1H-3-benzazepine [PDF Version]
    [¹¹C]NNC 112
    Kam Leung.
    Created: March 17, 2006; Last Update: January 12, 2008.
  - (+)-p-[¹¹C]Methylvesamicolphenoxy) [PDF Version]
    (+)-[¹¹C]PMV
    Kenneth T. Cheng.
    Created: July 12, 2006; Last Update: January 23, 2008.
  - (1R,2R)-N-(3-(4-[¹¹C]Methoxyphenyl)-4-methylisothiazol-5-yl)-2-methylcyclopropane-carboxamide [PDF Version]
    [¹¹C]LY2428703
    Kam Leung.
    Created: January 18, 2013; Last Update: April 11, 2013.
  - (20R)-4,5-α-Epoxy-17-methyl-3-hydroxy-6-[¹¹C]methoxy-α,17-dimethyl-α-(2-phenylethyl)-6,14-ethenomorphinan-7-methanol [PDF Version]
    [¹¹C]PEO
    Kam Leung.
    Created: October 24, 2009; Last Update: March 4, 2010.
  - (2-methoxy-¹¹C)-N-(4-(3,4-Dihydro-6,7-dimethoxy-isoquinolin-2(1H)-yl)butyl)-5-methylbenzamide [PDF Version]
    [¹¹C]RHM-1
    Kam Leung.
    Created: July 31, 2006; Last Update: May 18, 2008.
  - (2S,3S)-(2-[¹¹C]Methoxy-5-tetrazol-1-ylbenzyl)(2-phenylpiperidin-3-yl)amine [PDF Version]
    [¹¹C]GR203040
    Kenneth T. Cheng.
    Created: August 30, 2006; Last Update: February 4, 2008.
  - (2S,3S)-2-[α-(2-[¹¹C]Methylphenoxy)phenylmethyl]morpholine [PDF Version]
    [¹¹C]MENET-1
    Kam Leung.
    Created: February 9, 2009; Last Update: May 15, 2009.
  - (2S,3S)-N-[[2-[¹¹C]Methoxy-5-[5-(trifluoromethyl)tetrazol-1-yl]phenyl]methyl]-2-phenyl-piperidin-3-amine [PDF Version]
    [¹¹C]GR205171
    Kenneth T. Cheng.
    Created: July 19, 2006; Last Update: April 3, 2008.
  - (3-Ethyl-2-[¹¹C]methyl-6-quinolinyl)(cis-4-methoxycyclohexyl)methanone [PDF Version]
    [¹¹C]JNJ-16567083
    Kam Leung.
    Created: November 15, 2012; Last Update: March 14, 2013.
  - (3R,5R)-3-((R)-1-(4-Fluorophenyl)ethylamino)-5-(3-[¹¹C]methoxyphenyl)-1-(4-trifluoromethylphenyl)pyrrolidin-2-one [PDF Version]
    [¹¹C]FMePPEP
    Kam Leung and Sean Donohue.
    Created: August 6, 2010; Last Update: October 7, 2010.
  - (3R,5R)-5-(3-[¹¹C]Methoxy-phenyl)-3-((R)-1-phenyl-ethylamino)-1-(4-trifluoromethyl-phenyl)-pyrrolidin-2-one [PDF Version]
    [¹¹C]MePPEP
    Kam Leung and Sean Donohue.
    Created: August 6, 2010; Last Update: October 7, 2010.
  - (R,S)-1,2,3,4,10,14b-Hexahydro-2-[¹¹C]methylpyrazino(2,1-a)pyrido(2,3-c)(2)benzazepine [PDF Version]
    [¹¹C]Mirtazapine
    Kam Leung.
    Created: March 9, 2006; Last Update: March 27, 2006.
  - (R,S)-2-(N-Propyl-N-1'-[¹¹C]-propyl)amino-5-hydroxytetralin [PDF Version]
    [¹¹C]-5-OH-DPAT
    Kam Leung.
    Created: August 26, 2006; Last Update: February 1, 2008.
  - (R)-(-)-2-Chloro-N-[1-¹¹C-propyl]n-propylnorapomorphine [PDF Version]
    2-Cl-[¹¹C]-(-)-NPA
    Kam Leung.
    Created: October 24, 2010; Last Update: December 11, 2010.
  - (R)-(+)-8-Chloro-2,3,4,5-tetrahydro-3-[¹¹C]methyl-5-phenyl-1H-3-benzazepin-7-ol ([¹¹C]SCH 23390) [PDF Version]
    [¹¹C]SCH 23390
    Kam Leung.
    Created: November 22, 2005; Last Update: January 16, 2012.
  - (R)-2,3,4,5,6,7-Hexahydro-1-[4-[1-[4-(2-[¹¹C]methoxyphenyl)piperazinyl]]-2-phenylbutyryl]-1H-azepine [PDF Version]
    (R)-[¹¹C]RWAY
    Kam Leung.
    Created: September 2, 2007; Last Update: October 22, 2007.
  - (R)-2-[¹¹C]Methoxy-N-n-propylnorapomorphine [PDF Version]
    [¹¹C]MNPA
    Kam Leung.
    Created: April 11, 2006; Last Update: February 1, 2012.
  - (S,S)-[¹¹C]Methylreboxetine [PDF Version]
    (S,S)-[¹¹C]MRB
    The MICAD Research Team.
    Created: April 19, 2006; Last Update: May 8, 2006.
  - (S)-1-(4–2-[¹¹C]Methoxybenzyl)-5-(2-phenoxymethyl-pyrrolidine-1-sulfonyl)-1H-indole-2,3-dione [PDF Version]
    [¹¹C]WC-98
    Kam Leung.
    Created: September 1, 2009; Last Update: September 30, 2009.
  - (S)-5-Methoxymethyl-3-[6-(4,4,4-trifluorobutoxy)benzo[d]isoxazol-3-yl]-oxazolidin-2-[¹¹C]one [PDF Version]
    [¹¹C]SL25.1188
    Kam Leung.
    Created: May 22, 2010; Last Update: July 7, 2010.
  - (S)-6-[(4-Chlorophenyl)(1H-1,2,4-triazol-1-yl)methyl]-1-[¹¹C]methyl-1H-benzotriazole [PDF Version]
    [¹¹C]Vorozole
    Kam Leung.
    Created: May 8, 2009; Last Update: July 1, 2009.
  - (S)-N-(1-Ethyl-2-pyrrolidinyl)methyl)-5-bromo-2-[¹¹C]methoxy-3-methoxybenzamide [PDF Version]
    [¹¹C]FLB 457
    Kam Leung.
    Created: April 11, 2006; Last Update: October 6, 2011.
  - [¹¹C](+)-4-N-Propyl-,3,4a,5,6,10b-hexahydro-2H-naphth[1,2-b][1,4]-oxazin-9-ol [PDF Version]
    [¹¹C](+)-PHNO
    Kam Leung.
    Created: May 2, 2006; Last Update: October 6, 2011.
  - [¹¹C](5R)-5-(Methoxymethyl)-3-[4-[(3R)-4,4,4-trifluoro-3-hydroxybutoxy]phenyl]-2-oxazolidinone [PDF Version]
    [¹¹C]Befloxatone
    Kam Leung.
    Created: July 15, 2006; Last Update: May 27, 2008.
  - [¹¹C]-[N-Methyl]3-[(3-fluorophenyl)sulfonyl]-8-(4-methyl-1-piperazinyl)quinoline [PDF Version]
    [¹¹C]-GSK215083
    Arvind Chopra.
    Created: February 6, 2012; Last Update: April 27, 2012.
  - [¹¹C]10-Methoxy-5-(2-propenyl)-2,5-dihydro-2,2,4-trimethyl-1H-[1]benzopyrano[3,4-f]quinoline [PDF Version]
    [¹¹C]AL-348
    Arvind Chopra.
    Created: January 13, 2009; Last Update: April 6, 2009.
  - [¹¹C]2-(2-((Dimethylamino)methyl)phenylthio)-5-(2-fluoroethyl)phenylamine [PDF Version]
    [¹¹C]AFE
    The MICAD Research Team.
    Created: February 15, 2006; Last Update: March 7, 2006.
  - [¹¹C]2-(2-(Dimethylaminomethyl)phenylthio)-5-fluoromethylphenylamine [PDF Version]
    [¹¹C]AFM
    The MICAD Research Team.
    Created: February 7, 2006; Last Update: February 14, 2006.
  - [¹¹C]2-(2-[2-Dimethylaminothiazol-5-yl]ethenyl)-6-(2-[fluoro]ethoxy)benzoxazole [PDF Version]
    [¹¹C]BF-227
    Kam Leung.
    Created: May 18, 2007; Last Update: August 26, 2008.
  - [¹¹C]2-(Dimethylamino)-N-(5,6-dihydro-6-oxophenanthridin-2-yl)acetamide [PDF Version]
    [¹¹C]PJ34
    The MICAD Research Team.
    Created: March 31, 2006; Last Update: March 31, 2006.
  - [¹¹C]2-2-(Dimethylaminomethyl)phenylthio)-5-fluorophenylamine [PDF Version]
    [¹¹C]AFA
    The MICAD Research Team.
    Created: January 25, 2006; Last Update: February 14, 2006.
  - [¹¹C]4-N-Methylamino-4´-hydroxystilbene [PDF Version]
    [¹¹C]SB-13
    The MICAD Research Team.
    Created: February 27, 2005; Last Update: March 3, 2005.
  - [¹¹C]5-Hydroxy-2-(4-methyaminophenyl)benzofuran [PDF Version]
    The MICAD Research Team.
    Created: October 7, 2006; Last Update: October 16, 2006.
  - [¹¹C]Acetate [PDF Version]
    Kam Leung.
    Created: December 8, 2005; Last Update: May 19, 2008.
  - [¹¹C]Acetoacetate [PDF Version]
    [¹¹C]ACAC
    Kam Leung.
    Created: October 18, 2008; Last Update: November 12, 2008.
  - [¹¹C]Carfentanil [PDF Version]
    [¹¹C]CFN
    Kam Leung.
    Created: March 24, 2007; Last Update: February 14, 2013.
  - [¹¹C]Choline [PDF Version]
    [¹¹C]CH
    Kam Leung.
    Created: October 1, 2004; Last Update: February 7, 2011.
  - [¹¹C]Glycylsarcosine [PDF Version]
    [¹¹C]Gly-Sar
    Kam Leung.
    Created: September 21, 2008; Last Update: November 17, 2008.
  - [¹¹C]meta-Hydroxyephedrine [PDF Version]
    [¹¹C]mHED
    Kenneth T. Cheng.
    Created: January 19, 2006; Last Update: June 30, 2008.
  - [¹¹C]Methylated LY2181308 [PDF Version]
    [¹¹C]LY2181308
    Kam Leung.
    Created: January 27, 2011; Last Update: April 27, 2011.
  - [¹¹C]N,N-Dimethyl-2-(2´-amino-4´-hydroxymethylphenylthio)benzylamine [PDF Version]
    [¹¹C]HOMADAM
    The MICAD Research Team.
    Created: January 10, 2005; Last Update: February 27, 2005.
  - [¹¹C]N,N-Dimethyl-2-(2-amino-4-cyanophenylthio)benzylamine [PDF Version]
    [¹¹C]DASB
    Kam Leung.
    Created: May 18, 2005; Last Update: June 24, 2008.
  - [¹¹C]N-(3-Ethynylphenyl)-6,7-bis(2-methoxyethoxy)-4-quinazolinamine [PDF Version]
    [¹¹C]Erlotinib
    Liang Shan.
    Created: May 18, 2009; Last Update: June 18, 2009.
  - [¹¹C]N-Methyl-N-phenyl-[2-(4-chlorophenyl)-6,8-dichloroimidazo[1,2-a]pyridin-3-yl]acetamide [PDF Version]
    [¹¹C]PBR7
    Kam Leung.
    Created: October 8, 2008; Last Update: December 2, 2008.
  - [¹¹C]Norepinephrine [PDF Version]
    [¹¹C]NE
    Kenneth T. Cheng.
    Created: February 14, 2006; Last Update: May 12, 2008.
  - [¹¹C]-p-Hydroxyphenethylguanidine [PDF Version]
    [¹¹C]-p-hydroxy-PG
    Kenneth T. Cheng, David M. Raffel, and Yong-Woon Jung.
    Created: January 18, 2007; Last Update: February 11, 2008.
  - [¹¹C]Triphenylmethylphosphonium [PDF Version]
    [¹¹C]TPMP
    Kam Leung.
    Created: September 21, 2006; Last Update: April 10, 2012.
  - [¹⁸F]-3-Fluoro-2-(4-((2-nitro-1H-imidazol-1-yl)methyl)-1H-1,2,3-triazol-1-yl)propan-1-ol [PDF Version]
    [¹⁸F]-HX4
    Arvind Chopra.
    Created: August 16, 2010; Last Update: September 23, 2010.
  - [1-methyl-¹¹C]8-Dicyclopropylmethyl-1-methyl-3-propylxanthine [PDF Version]
    [¹¹C]MPDX
    Kam Leung.
    Created: February 10, 2006; Last Update: July 6, 2008.
  - [4-O-methyl-¹¹C]-8-[(E)-2-(3,4-Dimethoxyphenyl)ethenyl]-1,3-diethyl-7-methylpurine-2,6-dione [PDF Version]
    [¹¹C]KW-6002
    Kam Leung.
    Created: September 9, 2008; Last Update: October 15, 2008.
  - [6-O-methyl-¹¹C]Diprenorphine [PDF Version]
    [¹¹C]DPN
    Kam Leung.
    Created: May 24, 2006; Last Update: May 12, 2007.
  - [7-methyl-¹¹C]-(E)-8-(3,4,5-Trimethoxystyryl)-1,3,7-trimethylxanthine [PDF Version]
    [¹¹C]TMSX
    Kam Leung.
    Created: February 17, 2006; Last Update: July 8, 2008.
  - [carbonyl-¹¹C](R,S)-(N-(2-(1-(4-(2-Methoxyphenyl)piperazinyl)(2-methylethyl)))-N-pyridinyl)cyclohexanecarboxamide [PDF Version]
    [carbonyl-¹¹C](R,S)-JWAY
    Kenneth T. Cheng.
    Created: October 16, 2006; Last Update: February 5, 2008.
  - [Carbonyl-¹¹C](S)-3-chloro-4-(4-((2-(pyridine-3-yl)pyrrolidin-1-yl)methyl)phenoxy)benzamide [PDF Version]
    [¹¹C]LY2795050
    Kam Leung.
    Created: March 21, 2013; Last Update: May 23, 2013.
  - [Carbonyl-¹¹C]N-(2-(1-(4-(2-Methoxyphenyl)-piperazinyl)ethyl)-N-pyridinyl)cyclohexanecarboxamide [PDF Version]
    [Carbonyl-¹¹C]WAY 100635
    The MICAD Research Team.
    Created: November 11, 2005; Last Update: February 21, 2007.
  - [Carbonyl-¹¹C]-N-(4-Fluorobenzyl)-4-(3-(piperidin-1-yl)indole-1-sulfonyl)benzamide [PDF Version]
    [¹¹C]PipISB
    Kam Leung and Sean Donohue.
    Created: August 18, 2010; Last Update: October 28, 2010.
  - [N-¹¹C-methyl]-[4-[(4-Methyl-1-piperazinyl)methyl]-N-[4-methyl-3-[[4-(3-pyridyl)-2-pyrimidinyl]amino]phenyl]benzamide [PDF Version]
    [N-¹¹C-methyl]Imatinib
    Arvind Chopra.
    Created: May 30, 2007; Last Update: June 18, 2009.
  - [N-Methyl-¹¹C]-(11β17α)-11-[4-(dimethylamino)phenyl]-17-hydroxy-21-[4-(methylsulfonyl)phenyl]-19-norpregna-4,9-dien-20-yn-3-one [PDF Version]
    [N-Methyl-¹¹C]Org 34850
    Arvind Chopra.
    Created: January 7, 2009; Last Update: April 6, 2009.
  - [N-methyl-¹¹C]4-(4-(4-Chlorophenyl)-4-hydroxypiperidin-1-yl)-2,2-diphenyl-N-dimethyl-butanamide [PDF Version]
    [¹¹C]Lop
    Kam Leung.
    Created: December 23, 2008; Last Update: February 24, 2009.
  - [N-methyl-¹¹C]4-(4-(4-Chlorophenyl)-4-hydroxypiperidin-1-yl)-2,2-diphenyl-N-methyl-butanamide [PDF Version]
    [¹¹C]dLop
    Kam Leung.
    Created: May 2, 2009; Last Update: December 3, 2009.
  - [O-¹¹C-methyl]4-N-(3-Bromoanilino)-6,7-dimethoxyquinazoline [PDF Version]
    [¹¹C]PD153035
    Kam Leung.
    Created: May 6, 2009; Last Update: July 7, 2009.
  - [O-methyl-¹¹C]2-(4-(4-(2-Methoxyphenyl)piperazin-1-yl)butyl)-4-methyl-1,2,4-triazine-3,5(2H,4H)dione [PDF Version]
    [¹¹C]MMP (CUMI-101)
    Kam Leung.
    Created: September 4, 2007; Last Update: June 20, 2012.
  - [O-methyl-¹¹C]2-{4-[4-(7-Methoxynaphthalen-1-yl)piperazin-1-yl]butyl}-4-methyl-2H-[1,2,4]triazine-3,5-dione [PDF Version]
    [¹¹C]MPT
    Kenneth T. Cheng.
    Created: January 30, 2007; Last Update: February 26, 2008.
  - [S-methyl-¹¹C]N,N-Dimethyl-4-(6-(methylthio)imidazo[1,2-a]pyridine-2-yl)aniline [PDF Version]
    [¹¹C]MeS-IMPY
    Kam Leung.
    Created: October 6, 2007; Last Update: November 19, 2007.
  - 1-([4-methoxy-¹¹C]-3,4-Dimethoxyphenethyl)-4-(3-phenylpropyl)piperazinephenoxy) [PDF Version]
    [¹¹C]SA4503
    Kenneth T. Cheng.
    Created: June 30, 2006; Last Update: February 6, 2008.
  - 1-([4-methoxy-¹¹C]3,4-Dimethoxyphenethyl)-4-[3-(4-fluorophenyl)propyl]piperazine [PDF Version]
    [¹¹C]SA5845
    Kenneth T. Cheng.
    Created: October 21, 2006; Last Update: May 21, 2008.
  - 1-(1-Phenylethyl)-1H-imidazole-5-carboxylic acid [11C]methyl ester [PDF Version]
    [¹¹C]MTO
    Kam Leung.
    Created: June 10, 2005; Last Update: July 18, 2005.
  - 1-(2,4-Dichlorophenyl)-4-cyano-5-(4-[¹¹C]methoxyphenyl)-N-(pyrrolidin-1-yl)-1H-pyrazole-3-carboxamide [PDF Version]
    [¹¹C]JHU76609
    Kam Leung.
    Created: June 25, 2010; Last Update: August 26, 2010.
  - 1-(2-Chlorophenyl)-N-[¹¹C]methyl-N-(1-methylpropyl)-3-isoquinoline carboxamide [PDF Version]
    [¹¹C]PK11195
    Kam Leung.
    Created: January 6, 2006; Last Update: February 22, 2012.
  - 1-(3,4-[¹¹C]Dimethoxyphenethyl)-4-[3-(3,4-dichlorophenyl)propyl]piperazinephenoxy) [PDF Version]
    [¹¹C]SA6298
    Kenneth T. Cheng.
    Created: December 28, 2006; Last Update: May 21, 2008.
  - 1-(3-[¹¹C]Methoxy-4-methoxybenzyl)-6,7-dimethoxyisoquinoline [PDF Version]
    [¹¹C]Papaverine
    Kam Leung.
    Created: December 12, 2010; Last Update: March 2, 2011.
  - 1-(9H-Carbazol-4-yloxy)-3-(2-(2-[¹¹C]methoxyphenoxy)ethylamino)-propan-2-ol [PDF Version]
    [¹¹C]Carvedilol
    Kam Leung.
    Created: December 30, 2005; Last Update: February 14, 2012.
  - 1-(Benzofuran-2-ylmethyl)-4-(4-[¹¹C]methoxybenzyl)piperazine [PDF Version]
    [¹¹C]13
    Liang Shan.
    Created: May 10, 2012; Last Update: June 27, 2012.
  - 1-[¹¹C]Arachidonic acid [PDF Version]
    1-[¹¹C]AA
    Arvind Chopra.
    Created: December 29, 2008; Last Update: January 14, 2009.
  - 1-[¹¹C]Methylpiperidin-4-yl propionate [PDF Version]
    [¹¹C]PMP
    Kam Leung.
    Created: May 1, 2006; Last Update: February 28, 2012.
  - 1-¹¹C-Methyl-4-piperidinyl n-butyrate [PDF Version]
    ¹¹C-MP4B
    Liang Shan.
    Created: October 20, 2009; Last Update: December 14, 2009.
  - ¹¹C/⁶⁸Ga-Labeled sel-tagged anti-epidermal growth factor receptor 2 affibody Z_HER2:342 [PDF Version]
    [¹¹C/⁶⁸Ga]Z_HER2:342-ST
    Arvind Chopra.
    Created: October 2, 2012; Last Update: October 25, 2012.
  - ¹¹C-Labeled 1,7β,10β-trihydroxy-9-oxo-5β,20-epoxytax-11-ene-2α,4,13α-triyl 4-acetate 2-benzoate 13-{(2R,3S)-3-[(tert-butoxycarbonyl)amino]-2-hydroxy-3-phenylpropanoate} [PDF Version]
    [¹¹C]-Docetaxel
    Arvind Chopra.
    Created: July 22, 2011; Last Update: August 25, 2011.
  - ¹¹C-Labeled 6-[(3-cyclobutyl-2,3,4,5-tetrahydro-1H-3-benzazepin-7-yl)oxy]-N-methyl-3-pyridinecarboxamide hydrochloride [PDF Version]
    [¹¹C]GSK189254
    Arvind Chopra.
    Created: December 11, 2009; Last Revision: July 14, 2010.
  - ¹¹C-Labeled GSK931145 [PDF Version]
    [¹¹C]GSK931145
    Arvind Chopra.
    Created: March 2, 2012; Last Update: April 19, 2012.
  - ¹¹C-Labeled isoniazid [PDF Version]
    [¹¹C]INH
    Liang Shan.
    Created: August 2, 2010; Last Update: October 1, 2010.
  - ¹¹C-Labeled pyrazinamide [PDF Version]
    [¹¹C]PZA
    Liang Shan.
    Created: August 2, 2010; Last Update: October 1, 2010.
  - ¹¹C-Labeled rhodamine-123 [PDF Version]
    [¹¹C]Rhodamine-123
    Arvind Chopra.
    Created: November 19, 2012; Last Update: December 27, 2012.
  - ¹¹C-Labeled rifampicin [PDF Version]
    [¹¹C]RIF
    Liang Shan.
    Created: August 2, 2010; Last Update: September 1, 2010.
  - ¹¹C-Labeled Telmisartan, an angiotensin II type 1 receptor antagonist [PDF Version]
    [¹¹C]Telmisartan
    Arvind Chopra.
    Created: July 30, 2012; Last Update: August 30, 2012.
  - 1R-[¹¹C]Phenylephrine [PDF Version]
    [¹¹C]PHEN
    Kenneth T. Cheng.
    Created: January 25, 2006; Last Update: March 17, 2008.
  - 2,2,3,3-Tetramethylcyclopropanecarboxylic acid [3-(2-[¹¹C]methoxyethyl)-4,5-dimethyl-3H-thiazol-(2Z)-ylidene]amide [PDF Version]
    [¹¹C]A-836339
    Kam Leung.
    Created: December 6, 2010; Last Update: January 27, 2011.
  - 2-(2-(3-[¹¹C]Methoxyphenyl)ethynyl)pyridine [PDF Version]
    [¹¹C]M-MPEP
    Kenneth T. Cheng.
    Created: January 16, 2008; Last Update: February 25, 2008.
  - 2-(2-(5-[¹¹C]Methoxypyridin-3-yl)ethynyl)pyridine [PDF Version]
    [¹¹C]M-PEPy
    Kenneth T. Cheng.
    Created: February 7, 2008; Last Update: March 18, 2008.
  - 2-(2-[[O-¹¹C]Tolyl)vinyl]-4,5-dihydro-1H-imidazole [PDF Version]
    [¹¹C]Metrazoline
    Kam Leung.
    Created: February 24, 2012; Last Update: June 21, 2012.
  - 2-(3,4-Dimethoxyphenyl)-5-[2-(3,4-dimethoxyphenyl)ethyl-[¹¹C]methyl-amino]-2-propan-2-yl-pentanenitrile [PDF Version]
    [¹¹C]Verapamil
    Kam Leung.
    Created: December 20, 2005; Last Update: February 7, 2012.
  - 2-(3-Fluoro-[4-¹¹C]tolyl)-4,5-dihydro-1H-imidazole [PDF Version]
    [¹¹C]FTIMD
    Kam Leung.
    Created: February 19, 2012; Last Update: May 30, 2012.
  - 2-(4-Bromo-2,5-dimethoxyphenyl)-N-(2-[¹¹C]methoxybenzyl)ethanamine [PDF Version]
    [¹¹C]CIMBI-36
    Kam Leung.
    Created: February 18, 2011; Last Update: March 30, 2011.
  - 2-(4-Iodo-2,5-dimethoxyphenyl)-N-(2-[¹¹C]methoxybenzyl)ethanamine [PDF Version]
    [¹¹C]CIMBI-5
    Kam Leung.
    Created: January 18, 2011; Last Update: March 23, 2011.
  - 2-(5-[¹¹C]Methyl-hexahydro-pyrrolo[3,4-c]pyrrol-2-yl)-xanthene-9-one [PDF Version]
    [¹¹C]A-844606
    Kam Leung.
    Created: October 12, 2010; Last Update: January 19, 2011.
  - 2-(6-[¹¹C]Methyl-3,6-diazabicyclo[3.2.0]heptan-3-yl)-7-(6-methyl-3,6-diazabicyclo[3.2.0]heptan-3-yl)-9H-fluoren-9-one [PDF Version]
    [¹¹C]A-752274
    Arvind Chopra.
    Created: April 9, 2013.
  - 2-[¹¹C]Methyl-5-[6-phenylpyridazine-3-yl]octahydropyrrolo[3,4-c]pyrrole [PDF Version]
    [¹¹C]A-582941
    Kam Leung.
    Created: October 12, 2010; Last Update: January 14, 2011.
  - 2-[¹¹C]Methyl-6-(2-phenylethynyl)pyridine [PDF Version]
    [¹¹C]MPEP
    Kenneth T. Cheng.
    Created: November 15, 2007; Last Update: February 4, 2008.
  - 2-[2-([O-¹¹C]Tolyl)ethyl]-4,5-dihydro-1H-imidazole [PDF Version]
    [¹¹C]TEIMD
    Kam Leung.
    Created: February 22, 2012; Last Update: June 21, 2012.
  - 2-[methyl-¹¹C]Methoxyestradiol [PDF Version]
    [¹¹C]2-ME
    Kam Leung.
    Created: September 28, 2007; Last Update: December 4, 2007.
  - 2-Butyl-5-[¹¹C]methoxymethyl-6-(1-oxopyridin-2-yl)-3-[[2'-(1H-tetrazol-5-yl)biphenyl-4-yl]methyl]-3H-imidazo[4,5-b]pyridine [PDF Version]
    [¹¹C]KR31173
    Kam Leung.
    Created: May 12, 2006; Last Update: March 21, 2012.
  - 2-chloro-N-((S)-((S)-1-[¹¹C]methylpiperidine-2-yl)(thiophen-3-yl)methyl)-3-(trifluoromethyl)benzamide ([¹¹C]SA1) and derivatives [PDF Version]
    [¹¹C]SA1, [¹¹C]SA2, and [¹¹C]SA3
    Arvind Chopra.
    Created: February 14, 2012; Last Update: May 10, 2012.
  - 2-Hydroxy-3-isobutyl-9-[¹¹C]methoxy-10-methoxy-1,2,3,4,6,7,-hexahydro-11bH-bezo[α]-quinolizine [PDF Version]
    [¹¹C]DTBZ
    Kam Leung.
    Created: March 17, 2006; Last Update: October 27, 2010.
  - 2β-Carbo[¹¹C]methoxy-3β-(3´-((Z)-2-iodoethenyl)phenyl)nortropane [PDF Version]
    [¹¹C]mZIENT
    Jeffrey Stehouwer and Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - 2β-Carbo[¹¹C]methoxy-3β-(4´-((Z)-2-iodoethenyl)phenyl)nortropane [PDF Version]
    [¹¹C]pZIENT
    Jeffrey Stehouwer and Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - 2’-Fluoro-5-([¹¹C]-methyl)-1-β-D-arabinofuranosyluracil [PDF Version]
    [¹¹C]FMAU
    Arvind Chopra.
    Created: January 2, 2008; Last Update: January 24, 2008.
  - 3-(6-Methyl-pyridin-2-ylethynyl)-cyclohex-2-enone-O-¹¹C-methyl-oxime [PDF Version]
    [¹¹C]ABP688
    Kenneth T. Cheng.
    Created: April 27, 2006; Last Update: April 28, 2008.
  - 3-[3,5-Dimethyl-4-(4-[¹¹C]methylpiperazinecarbonyl)-1H-pyrrol-2-ylmethylene]-2-oxo-2,3-dihydro-1H-indole-5-sulfonic acid (3-chlorophenyl)methylamide [PDF Version]
    [¹¹C]SU11274
    Kam Leung.
    Created: April 17, 2010; Last Update: March 12, 2012.
  - 3-Fluoromethyl-N-[¹¹C]methyl-4-phenyl-N-(phenylmethyl)quinoline-2-carboxamide [PDF Version]
    [¹¹C]PBR6a
    Kam Leung.
    Created: August 9, 2007; Last Update: September 17, 2007.
  - 3-N-[¹¹C]Methylspiperone [PDF Version]
    [¹¹C]NMSP
    Kam Leung.
    Created: November 3, 2005; Last Update: October 6, 2011.
  - 4-(3-Cyclopentoxy-4-[¹¹C]methoxy-phenyl)pyrrolidin-2-one [PDF Version]
    [¹¹C]Rolipram
    Kam Leung.
    Created: January 12, 2006; Last Update: January 12, 2008.
  - 4-[¹¹C]Methylphenyl-1,4-diazabicyclo[3.2.2]nonane-4-carboxylate [PDF Version]
    [¹¹C]CHIBA-1001
    Kam Leung.
    Created: December 12, 2008; Last Update: October 7, 2010.
  - 4-Acetoxy-7-chloro-3-(3-(-4-[¹¹C]methoxybenzyl)phenyl)-2(1H)-quinolone [PDF Version]
    [¹¹C]AcL703,717
    Kam Leung.
    Created: May 8, 2009; Last Update: June 12, 2009.
  - 4-Cyano-1-(2,4-dichlorophenyl)-5-(4-[¹¹C]methoxyphenyl)-N-(piperidin-1-yl)-1H-pyrazole-3-carboxamide [PDF Version]
    [¹¹C]JHU75528
    Kam Leung.
    Created: February 16, 2007; Last Update: March 5, 2007.
  - 4-Hydroxy-, 5-hydroxy-, and 7-hydroxy- analogs of 6-hydroxy-2-(4’-[¹¹C]methylaminophenyl)-1,3-benzothiazole [PDF Version]
    [¹¹C]6a, [¹¹C]6b, and [¹¹C]6c
    Arvind Chopra.
    Created: December 8, 2009; Last Update: January 7, 2009.
  - 5-(6-(5-[¹¹C]methylhexahydropyrrolo[3,4-c]pyrrol-2(1H)-yl)pyridazin-3-yl)-1H-indole [PDF Version]
    [¹¹C]A-833834
    Arvind Chopra.
    Created: April 9, 2013; Last Update: June 27, 2013.
  - 5-Amino-7-(3-(4-[¹¹C]methoxy)phenylpropyl)-2-(2-furyl)pyrazolo[4,3-e]-1,2,4-triazolo[1,5-c]pyrimidine [PDF Version]
    [¹¹C]SCH442416
    Kam Leung.
    Created: July 7, 2007; Last Update: July 8, 2008.
  - 5-Methyl-8-(4-[¹¹C]methyl-piperazin-1-yl)-4-oxo-4H-chromene-2-carboxylic acid (4-morpholin-4-yl-phenyl)-amide [PDF Version]
    [¹¹C]AZ10419369
    Kam Leung.
    Created: May 4, 2009; Last Update: July 1, 2009.
  - 6,7-Dimethoxy-2-[3-(5-[¹¹C]methoxy-1,2,3,4-tetrahydro-naphthalen-1-yl)-propyl]-1,2,3,4-tetrahydro-isoquinoline [PDF Version]
    [¹¹C]MC-266
    Kam Leung.
    Created: June 24, 2010; Last Update: September 15, 2010.
  - 6,7-Dimethoxy-2-{3-[4-[¹¹C]methoxy-3,4-dihydro-2H-naphthalen-(1E)-ylidene]-propyl}-1,2,3,4-tetrahydro-isoquinoline [PDF Version]
    [¹¹C]6
    Kam Leung.
    Created: June 24, 2010; Last Update: September 15, 2010.
  - 6-Hydroxy-[1,1'-biphenyl]-3-yl-cyclohexyl-[¹¹C-carbonyl]carbamate [PDF Version]
    [¹¹C]CURB
    Kam Leung.
    Created: October 24, 2012; Last Update: March 21, 2013.
  - 7-[ ¹¹C]Methoxy-1-methyl-9H-[3,4-b]indole [PDF Version]
    [¹¹C]HAR
    Kam Leung.
    Created: June 23, 2006; Last Update: March 14, 2012.
  - 8-((E)-4-Fluoro-but-2-enyl)-3β-p-tolyl-8-aza-bicyclo[3.2.1]octane-2β-carboxylic acid [¹¹C]methyl ester [PDF Version]
    [¹¹C]LBT-999
    Kam Leung.
    Created: December 11, 2008.
  - Biphenyl-3-yl-4-[¹¹C]methoxyphenylcarbamate [PDF Version]
    [¹¹C]URB597-1
    Kam Leung.
    Created: December 18, 2012; Last Update: February 21, 2013.
  - Dimethylamino-3(4-[¹¹C]methoxyphenyl)-3H-pyrido[3',2':4,5]thieno[3,2-d]pyrimidin-4-one [PDF Version]
    [¹¹C]MMTP
    Kam Leung.
    Created: December 5, 2012; Last Update: February 21, 2013.
  - Ethyl 8-fluoro-5-[¹¹C]methyl-6-oxo-4H-imidazo[1,5-a][1,4]benzodiazepine-3-carboxylate [PDF Version]
    [¹¹C]FMZ
    Arvind Chopra.
    Created: April 28, 2008; Last Update: June 10, 2008.
  - L-[5-¹¹C]-Glutamine [PDF Version]
    L-[5-¹¹C]-Gln
    Kam Leung.
    Created: January 7, 2012; Last Update: March 22, 2012.
  - l-[methyl-¹¹C]Methionine [PDF Version]
    [¹¹C]MET
    Kam Leung.
    Created: September 15, 2005; Last Update: December 21, 2011.
  - Methyl-[¹¹C]-4'-thiothymidine [PDF Version]
    [¹¹C]-4DST
    Arvind Chopra.
    Created: August 1, 2011; Last Update: September 8, 2011.
  - N,N-Diethyl-2-2(2-(4-[¹¹C]methoxyphenyl)-5,7-dimethyl-pyrazolo(1,5-a)pyrimidin-3-yl)-acetamide [PDF Version]
    [¹¹C]DPA-713
    Elisabeth Lutanie and Kam Leung.
    Created: April 19, 2006; Last Update: March 11, 2010.
  - N-(2-[¹¹C],5-Dimethoxybenzyl)-N-(5-fluoro-2-phenoxyphenyl)acetamide [PDF Version]
    [¹¹C]DAA1106
    Kam Leung.
    Created: January 30, 2006; Last Update: January 2, 2008.
  - N-(4-(6-(Isopropylamino)pyrimidin-4-yl)-1,3-thiazol-2-yl)-4-[¹¹C]methoxy-N-methylbenzamide [PDF Version]
    [¹¹C]ITMM
    Kam Leung.
    Created: February 14, 2013; Last Update: May 2, 2013.
  - N-(4-(6-(Isopropylamino)pyrimidin-4-yl)-1,3-thiazol-2-yl)-N-methyl-4-[¹¹C]methylbenzamide [PDF Version]
    [¹¹C]ITDM
    Kam Leung.
    Created: February 19, 2013; Last Update: May 2, 2013.
  - N-[(1s)-1-[4-[[4-methoxy-2-[(4-[¹¹C]methoxyphenyl)sulfonyl]-phenyl]sulfonyl]phenyl]ethyl]methanesulfonamide [PDF Version]
    [¹¹C]Methoxy-Sch225336
    Arvind Chopra.
    Created: May 12, 2010; Last Update: June 3, 2010.
  - N-[[4'-[(2-Ethyl-5,7-dimethyl-3H-imidazo[4,5-b]pyridine-3-yl)methyl][1,1'-biphenyl]-2-yl]sul-fonyl]-4-[¹¹C]methoxybenzamide [PDF Version]
    [¹¹C]L-159,884
    Kam Leung.
    Created: May 17, 2006; Last Update: March 14, 2012.
  - N-[¹¹C]Methyl-3-[[(dimethylamino)carbonyl]oxy]-2-(2’,2’-diphenylpropionoxymethyl)pyridinium [PDF Version]
    [¹¹C]MDDP
    The MICAD Research Team.
    Created: June 24, 2006; Last Update: July 25, 2006.
  - N-[¹¹C]Methylpiperidin-4-yl acetate [PDF Version]
    [¹¹C]MP4A
    Kam Leung.
    Created: April 19, 2006; Last Update: February 22, 2012.
  - N-[2-[4-(3-Cyanopyridin-2-yl)piperazin-1-yl]ethyl]-3-[¹¹C]methoxybenzamide [PDF Version]
    [¹¹C]7
    Kam Leung.
    Created: May 5, 2013; Last Update: June 13, 2013.
  - N-[N-[(S)-1,3-Dicarboxypropyl]carbamoyl]-S-[¹¹C]methyl-L-cysteine [PDF Version]
    [¹¹C]DCMC
    Arvind Chopra.
    Created: March 1, 2007; Last Update: December 6, 2007.
  - N1’-([¹¹C]Methyl)naltrindole [PDF Version]
    [¹¹C]MeNTI
    Kam Leung.
    Created: April 12, 2007; Last Update: May 8, 2007.
  - N2-{6-[(4-Amino-6,7-dimethoxy-2-quinazolinyl)(methyl)amino]hexyl}-N2-[¹¹C]methyl-2-furamide [PDF Version]
    [¹¹C]GB67
    Kam Leung.
    Created: February 2, 2006; Last Update: February 27, 2006.
  - N-4-Fluorobut-2-yn-1-yl-2β-carbo-[¹¹C]methoxy-3β-phenyltropane [PDF Version]
    [¹¹C]PR04.MZ
    Kam Leung.
    Created: August 8, 2011; Last Update: November 3, 2011.
  - N-Acetyl-N-(2-[¹¹C]methoxybenzyl)-2-phenoxy-5-pyridinamine [PDF Version]
    [¹¹C]PBR28
    Kam Leung.
    Created: June 12, 2007; Last Update: August 25, 2011.
  - N-Benzyl-N-ethyl -2-(7-[¹¹C]-methyl-8-oxo-2-phenyl-7,8-dihydro-9H-purin-9-yl)acetamide [PDF Version]
    [¹¹C]AC-5216
    Kazuhiko Yanamoto and Ming-Rong Zhang.
    Created: December 4, 2007; Last Update: December 31, 2007.
  - N-Methyl-[¹¹C]-2-(4'-methylaminophenyl)-6-hydroxybenzothiasole [PDF Version]
    [¹¹C]6-OH-BTA-1 or [¹¹C]PIB
    Kam Leung.
    Created: July 11, 2005; Last Update: July 25, 2005.
  - O-[¹¹C]methyl derivative of 6,7-dimethoxy-2-(4-methoxy-biphenyl-4-yl-methyl)-1,2,3,4-tetrahydro-isoquinoline [PDF Version]
    [¹¹C]MC113
    Arvind Chopra.
    Created: November 5, 2012; Last Update: January 31, 2013.
  - R-(−)-[¹¹C]Epinephrine [PDF Version]
    [¹¹C]EPI
    Kenneth T. Cheng.
    Created: March 28, 2006; Last Update: March 24, 2008.
  - S-[¹¹C]Methyl-L-cysteine [PDF Version]
    [¹¹C]MCYS
    Kam Leung.
    Created: March 11, 2012; Last Update: June 28, 2012.
  - S-4-(3-([¹¹C]Isopropylamino)-2-hydroxypropoxy)-2H-benzimidazol-2-one [PDF Version]
    S-[¹¹C]CGP 12388
    Kam Leung.
    Created: January 20, 2006; Last Update: February 12, 2011.
  - trans-(+)-1,2,3,5,6,10b-Hexahydro-6-(4-([¹¹C]methylthio)-phenyl)pyrrolo-(2,1-a)-isoquinoline [PDF Version]
    [¹¹C](+)McN5652
    The MICAD Research Team.
    Created: March 7, 2006; Last Update: April 12, 2006.
- 124I
  - [¹²⁴I]Iodo-azomycin-galactoside [PDF Version]
    [¹²⁴I]IAZG
    Kam Leung.
    Created: November 22, 2007; Last Update: January 30, 2008.
  - ^124/131I-Labeled apoptosis-targeting peptide-1 (ApoPep-1) [PDF Version]
    [^124/131I]-ApoPep-1
    Arvind Chopra.
    Created: November 8, 2011; Last Update: December 1, 2011.
  - ¹²⁴I/⁶⁴Cu-Labeled anti-CD20 minibody [PDF Version]
    [¹²⁴I/⁶⁴Cu]Anti-CD20 ScFv-C_H3 dimer
    Arvind Chopra.
    Created: October 13, 2009; Last Update: November 24, 2009.
  - ¹²⁴I-Annexin V [PDF Version]
    Kenneth T. Cheng.
    Created: July 20, 2006; Last Update: January 2, 2008.
  - ¹²⁴I-Anti-CD44v6 chimeric monoclonal antibody U36 [PDF Version]
    ¹²⁴I-cMAb U36
    Kam Leung.
    Created: October 5, 2007; Last Update: November 19, 2007.
  - ¹²⁴I-Anti–prostate stem-cell antigen back-mutated 2B3 diabody [PDF Version]
    ¹²⁴I-bm2B3-Db8
    Kam Leung.
    Created: May 25, 2010; Last Update: August 1, 2010.
  - ¹²⁴I-Anti-PSCA 2B3 minibody [PDF Version]
    ¹²⁴I-2B3
    Kam Leung.
    Created: March 25, 2009; Last Update: May 13, 2009.
  - ¹²⁴I-Chimeric monoclonal antibody G250 [PDF Version]
    ¹²⁴I-cG250
    Kam Leung.
    Created: April 22, 2010; Last Update: May 20, 2010.
  - ¹²⁴I-Labeled antibody against lymphatic vessel endothelial hyaluronan receptor-1 (LYVE-1) [PDF Version]
    ¹²⁴I-Anti-LYVE-1
    Kam Leung.
    Created: March 22, 2011; Last Update: July 6, 2011.
  - ¹²⁴I-Labeled anti-CD20 scFv-sc fragment [PDF Version]
    [¹²⁴I]Anti-CD20 scFv-sc DM
    Arvind Chopra.
    Created: October 13, 2009; Last Update: November 24, 2009.
  - ¹²⁴I-Labeled anti-HER2-specific C6.5 diabody [PDF Version]
    ¹²⁴I-C6.5db
    Kam Leung.
    Created: May 22, 2011; Last Update: August 4, 2011.
  - ¹²⁴I-Labeled anti-prostate stem cell antigen affinity-matured A11 minibody [PDF Version]
    ¹²⁴I-A11
    Liang Shan.
    Created: June 23, 2010; Last Update: July 19, 2010.
  - ¹²⁴I-Labeled humanized CH2-domain-deleted anti-tumor-associated glycoprotein-72 (TAG-72) monoclonal antibody [PDF Version]
    [¹²⁴I]-HuCC49deltaC_H2
    Arvind Chopra.
    Created: September 22, 2011; Last Update: October 27, 2011.
  - ¹²⁴I-Labeled residulizing ligand IMP-R4 conjugated chimeric monoclonal antibody ch806 targeting the epidermal growth factor receptor deletion variant de2-7 (EGFRvIII) [PDF Version]
    [¹²⁴I]-IMP-R4-ch806
    Arvind Chopra.
    Created: June 26, 2010; Last Update: August 5, 2010.
  - 2'-Fluoro-2'-deoxy-5'-[^{123/124/125/131}I]iodo-1β-d-arabinofuranosyluracil [PDF Version]
    [^{123/124/125/131}I]FIAU
    Kam Leung.
    Created: February 1, 2005; Last Update: February 9, 2005.
- 13N
  - [¹³N]Ammonia [PDF Version]
    [¹³N]NH₃
    Kenneth T. Cheng.
    Created: December 5, 2005; Last Update: December 4, 2007.
- 149Tb, 152Tb, 155Tb, 161Tb
  - [^{149/152/155/161}Tb]-Labeled DOTA-folate conjugated to an albumin-binding entity [PDF Version]
    [^{149/152/155/161}Tb]cm09
    Arvind Chopra.
    Created: December 3, 2012; Last Update: December 27, 2012.
- 18F
  - (-)-7-Methyl-2-exo-[3'-(6-[¹⁸F]fluoropyridin-2-yl)-5'-pyridinyl]-7-azabicyclo[2.2.1]heptane [PDF Version]
    [¹⁸F](-)-6c
    Kam Leung.
    Created: April 12, 2009; Last Update: April 3, 2009.
  - (+)-2-Hydroxy-3-isobutyl-9-(3-[¹⁸F]fluoropropoxy)-10-methoxy-1,2,3,4,6,7-hexahydro-11bH-benzo[a]quinolizine [PDF Version]
    [¹⁸F]FP-(+)-DTBZ
    Kam Leung.
    Created: February 12, 2007; Last Update: October 14, 2010.
  - (1R,2S,3S,5S)-Methyl-8-{[(1S,2S)-2-([¹⁸F]fluoromethyl)cyclopropyl]methyl}-3-phenyl-8-azabicyclo[3.2.1]octane-2-carboxylate [PDF Version]
    [¹⁸F]PR17.MZ
    Kam Leung.
    Created: July 12, 2011; Last Update: December 8, 2011.
  - (20R)-4,5-α-Epoxy-6-(2-[¹⁸F])fluoroethoxy)-3-hydroxy-α,17-dimethyl-α-(2-phenyleth-1-yl)-6,14-ethenomorphinan-7-methanol [PDF Version]
    [¹⁸F]FE-PEO
    Kam Leung.
    Created: February 24, 2013; Last Update: April 25, 2013.
  - (3R,5R)-5-(3-(2-[¹⁸F]Fluoroethoxy)phenyl)-3-((R)-1-phenyl-ethylamino)-1-(4-trifluoromethyl-phenyl)-pyrrolidin-2-one [PDF Version]
    [¹⁸F]FEPEP
    Kam Leung and Sean Donohue.
    Created: August 6, 2010; Last Update: October 7, 2010.
  - (3R,5R)-5-(3-[¹⁸F]Fluoromethoxy-d₂)phenyl)-3-((R)-1-phenyl-ethylamino)-1-(4-trifluoromethyl-phenyl)-pyrrolidin-2-one [PDF Version]
    [¹⁸F]FMPEP-d₂
    Kam Leung and Sean Donohue.
    Created: August 6, 2010; Last Update: October 7, 2010.
  - (3R,5R)-5-(3-[¹⁸F]Fluoromethoxy-phenyl)-3-((R)-1-phenyl-ethylamino)-1-(4-trifluoromethyl-phenyl)-pyrrolidin-2-one [PDF Version]
    [¹⁸F]FMPEP
    Kam Leung and Sean Donohue.
    Created: August 6, 2010; Last Update: October 7, 2010.
  - (4S)-4-(3-[¹⁸F]Fluoropropyl)-l-glutamate [PDF Version]
    [¹⁸F]FSPG
    Arvind Chopra.
    Created: March 20, 2013; Last Update: May 23, 2013.
  - (E)-2-(2-(2-(2-[¹⁸F]Fluoroethoxy)ethoxy)ethoxy)-5-(4-dimethylaminostyryl)-pyridine [PDF Version]
    [¹⁸F]FPEGN3-Styrylpyridine
    Kam Leung.
    Created: February 2, 2007; Last Update: March 5, 2007.
  - (E)-3-(4-(Dimethylamino)phenyl)-1-(4-(2-(([¹⁸F]fluoroethoxy)ethoxy)ethoxy)phenyl)-2-propen-1-one [PDF Version]
    [¹⁸F]7c
    Kam Leung.
    Created: July 11, 2010; Last Update: October 20, 2010.
  - (E)-3-(Pyridin-2-ylethynyl)-cyclohex-2-enone-O-2-(2-[¹⁸F]fluoroethoxy)ethyl oxime [PDF Version]
    [¹⁸F]FDEGPECO
    Kam Leung.
    Created: June 5, 2011; Last Update: September 29, 2011.
  - (E)-4-(2-(6-(2-(2-(2-([¹⁸F]-fluoroethoxy)ethoxy)ethoxy)pyridin-3-yl)vinyl)-N-methylbenzenamine [PDF Version]
    [¹⁸F]AV-45
    Kam Leung.
    Created: February 11, 2010; Last Update: December 9, 2010.
  - (R,S)-2-(N-Propyl-N-5'-[¹⁸F]fluoropentyl)amino-5-hydroxytetralin [PDF Version]
    [¹⁸F]-5-OH-FPPAT
    Kam Leung.
    Created: August 27, 2006; Last Update: February 1, 2008.
  - (R,S)-anti-1-Amino-2-[¹⁸F]fluorocyclopentyl-1-carboxylic acid [PDF Version]
    anti-2-[¹⁸F]FACPC
    Kam Leung.
    Created: November 18, 2010; Last Update: February 10, 2011.
  - (R)-2-(N-Benzyl-4-(2-[¹⁸F]fluoroethoxy)phenylsulfonamido)-N-hydroxy-3-methylbutanamide [PDF Version]
    [¹⁸F]1f
    Kam Leung.
    Created: March 10, 2008; Last Update: May 12, 2008.
  - (R)-2-Amino-3-[¹⁸F]fluoro-2-methylpropanoic acid [PDF Version]
    (R)-[¹⁸F]FAMP
    Kam Leung.
    Created: May 18, 2010; Last Update: July 29, 2010.
  - (R)-3-[¹⁸F]Fluoro-2-methyl-2-N-(methylamino)propanoic acid [PDF Version]
    (R)-[¹⁸F]NMeFAMP
    Kam Leung.
    Created: May 18, 2010; Last Update: July 29, 2010.
  - (S,S)-2-(α-(2-[¹⁸F]Fluoro[²H₂]methoxyphenoxy)phenoxy)benzyl)morpholine [PDF Version]
    (S,S)-[¹⁸F]FMeNER-D₂
    Kenneth T. Cheng.
    Created: May 5, 2006; Last Update: March 24, 2008.
  - (S,S)-2-[α-(2-(2-[¹⁸F]Fluoro[²H₄]ethoxy)phenoxy)benzyl]morpholine [PDF Version]
    (S,S)-[¹⁸F]FRB-D₄
    Kenneth T. Cheng.
    Created: September 14, 2006; Last Update: January 23, 2008.
  - (S,S)-2-[α-(2-(2-[¹⁸F]Fluoroethoxy)phenoxy)benzyl]morpholine [PDF Version]
    (S,S)-[¹⁸F]FRB
    Kenneth T. Cheng.
    Created: August 9, 2006; Last Update: January 23, 2008.
  - (S)-1-((1-(2-[¹⁸F]Fluoroethyl)-1H-[1,2,3]-triazol-4-yl)methyl)-5-(2-4-difluorophenoxymethyl-pyrrolidine-1-sulfonyl)isatin [PDF Version]
    [¹⁸F]Isatin-15
    Kam Leung.
    Created: August 28, 2009; Last Update: September 30, 2009.
  - (S)-1-(4-(2-[¹⁸F]Fluoroethoxy)benzyl)-5-[1-(2-methoxymethyl-pyrrolidinyl)sulfonyl]-1H-indole-2,3-dione [PDF Version]
    [¹⁸F]CbR2
    Kam Leung.
    Created: June 29, 2007; Last Update: February 16, 2008.
  - (S)-2-Amino-3-[1-(2-[¹⁸F]fluoroethyl)-1H-[1,2,3]triazol-4-yl]propanoic acid [PDF Version]
    (S)-[¹⁸F]4
    Kam Leung.
    Created: July 7, 2011; Last Update: October 27, 2011.
  - (S)-N-((1-Allyl-2-pyrrolidinyl)methyl)-5-(3-[¹⁸F]fluoropropyl)-2,3-dimethoxybenzamide [PDF Version]
    [¹⁸F]Fallypride
    Kam Leung.
    Created: November 29, 2005; Last Update: January 12, 2008.
  - (S)-N-((1-Allyl-2-pyrrolidinyl)methyl)-5-(3-[¹⁸F]fluoropropyl)-2-methoxybenzamide [PDF Version]
    [¹⁸F]DMFP
    Kam Leung.
    Created: August 3, 2006; Last Update: May 17, 2008.
  - [¹⁸F]1-(2-Fluoroethyl)-4-[(4-cyanophenoxy)methyl]piperidine [PDF Version]
    [¹⁸F]SFE
    Kenneth T. Cheng.
    Created: November 1, 2006; Last Update: February 5, 2008.
  - [¹⁸F]1-(3-Fluoropropyl)-4-[(4-cyanophenoxy)methyl]piperidine [PDF Version]
    [¹⁸F]FPS
    Kenneth T. Cheng.
    Created: November 18, 2006; Last Update: December 20, 2007.
  - [¹⁸F]-2-(2-Nitroimidazol-1H-yl)-(3,3,3-trifluoropropyl)acetamide [PDF Version]
    [¹⁸F]EF3
    Kam Leung.
    Created: September 10, 2007; Last Update: October 22, 2007.
  - [¹⁸F]3-(1H-Imidazol-4-yl)propyl-4-fluorobenzyl ether [PDF Version]
    [¹⁸F]Fluoroproxyfan
    Kam Leung.
    Created: December 3, 2007; Last Update: January 28, 2008.
  - [¹⁸F]3-Fluoro-5-[(2-methyl-1,3-thiazol-4-yl)ethynyl]benzonitrile [PDF Version]
    [¹⁸F]F-MTEB
    The MICAD Research Team.
    Created: July 12, 2006; Last Update: July 24, 2006.
  - [¹⁸F]3-Fluoro-5-[(pyridin-3-yl)ethynyl]benzonitrile [PDF Version]
    [¹⁸F]F-PEB
    Kenneth T. Cheng.
    Created: May 22, 2006.
  - [¹⁸F]-5-(2-fluoroethyl)2,4-diethyl-3-(ethylsulfanylcarbonyl)-6-phenylpyridine-5-carboxylate [PDF Version]
    [¹⁸F]FE@SUPPY
    Arvind Chopra.
    Created: December 26, 2007; Last Update: December 7, 2010.
  - [¹⁸F]5-(6-Fluorohexyn-1-yl)-3-[2(S)-2-azetidinylmethoxy]pyridine [PDF Version]
    [¹⁸F]ZW-104
    Kam Leung.
    Created: November 12, 2009; Last Update: January 14, 2010.
  - [¹⁸F]6-(2-Fluoropropyl)-4-methyl-pyridin-2-amine [PDF Version]
    [¹⁸F]iNOS-9
    Kam Leung.
    Created: August 11, 2009; Last Update: September 9, 2009.
  - [18F]6-fluoro-3-O-methyl-L-3,4-dihydroxyphenylalanine [PDF Version]
    [¹⁸F]OMFD
    Arvind Chopra.
    Created: December 13, 2007; Last Update: January 8, 2008.
  - [¹⁸F]FB-(Ac-NIe-Asp-His-d-Phe-Arg-Trp-Gly-Lys-NH₂) [PDF Version]
    [¹⁸F]FB-NAPamide
    Kenneth T. Cheng, Sam Gambhir, and Zhen Cheng.
    Created: August 2, 2007; Last Update: August 10, 2007.
  - [¹⁸F]FB-NH-mini-PEG-E{E[c(RGDyK)]₂}₂ [PDF Version]
    [¹⁸F]FPRGD4
    Kenneth T. Cheng.
    Created: February 20, 2008; Last Update: March 12, 2008.
  - [¹⁸F]Fluoro-[1,2-²H₄]choline [PDF Version]
    [¹⁸F]12c
    Kam Leung.
    Created: March 1, 2011; Last Update: June 23, 2011.
  - [¹⁸F]Fluoro-2-deoxy-2-D-glucose [PDF Version]
    [¹⁸F]FDG
    Kam Leung.
    Created: October 1, 2004; Last Update: January 12, 2005.
  - [¹⁸F]-Fluoro-2-deoxy-d-glucose-folate [PDF Version]
    [¹⁸F]-5
    Liang Shan.
    Created: October 1, 2012; Last Update: October 31, 2012.
  - [¹⁸F]Fluorobenzaldehyde-leptin [PDF Version]
    [¹⁸F]FBA-Leptin
    Kam Leung.
    Created: November 6, 2008; Last Update: December 12, 2008.
  - [¹⁸F]Fluorobenzoyl-((VHPKQHRGGSY)₂K)₂KK [PDF Version]
    [¹⁸F]4V
    Kam Leung.
    Created: June 29, 2010; Last Update: September 30, 2010.
  - [¹⁸F]Fluorobenzoyl anti-HER2 Cys-diabody [PDF Version]
    [¹⁸F]FB-Cys-Db
    Liang Shan.
    Created: October 31, 2012; Last Update: November 28, 2012.
  - [¹⁸F]Fluorobenzoyl-PEGylated cyclic arginine-glycine-aspartic acid peptide [PDF Version]
    [¹⁸F]FB-PEG-c(RGDyK)
    Kenneth T. Cheng and Peter S. Conti.
    Created: June 11, 2008; Last Update: July 4, 2008.
  - [¹⁸F]Fluorobenzyl-bombesin[7-14]-c(RGDyK) [PDF Version]
    [¹⁸F]FB-BBN-c(RGDyK)
    Kam Leung.
    Created: October 26, 2008; Last Update: December 2, 2008.
  - [¹⁸F]Fluorobenzyl-PEG₃-Glu-c(RGDyK)-bombesin[7-14] [PDF Version]
    [¹⁸F]FB-PEG₃-Glu-RGD-BBN
    Kam Leung.
    Created: April 26, 2009; Last Update: July 1, 2009.
  - [¹⁸F]Fluorocholine [PDF Version]
    [¹⁸F]FCH
    Kam Leung.
    Created: October 4, 2004; Last Update: February 1, 2011.
  - [¹⁸F]Fluorodipalmitin-labeled liposomes [PDF Version]
    [¹⁸F]FDP-liposomes
    Kam Leung.
    Created: May 12, 2008; Last Update: May 29, 2008.
  - [¹⁸F]Fluoroerythronitroimidazole [PDF Version]
    [¹⁸F]FETNIM
    The MICAD Research Team.
    Created: September 10, 2005; Last Update: February 6, 2006.
  - [¹⁸F]Fluoroetanidazole [PDF Version]
    [¹⁸F]FETA
    The MICAD Research Team.
    Created: September 28, 2005; Last Update: October 19, 2005.
  - [¹⁸F]Fluoroethylcholine [PDF Version]
    [¹⁸F]FECh
    Kam Leung.
    Created: March 1, 2011; Last Update: June 23, 2011.
  - [¹⁸F]Fluoroethyl-recombinant human interlukin-1 receptor antagonist [PDF Version]
    [¹⁸F]IL-1ra
    Kam Leung.
    Created: April 28, 2013; Last Update: June 6, 2013.
  - [¹⁸F]Fluoromethyl-d-tyrosine [PDF Version]
    d-[¹⁸F]FMT
    Arvind Chopra.
    Created: May 7, 2009; Last Update: June 18, 2009.
  - [¹⁸F]Fluoromisonidazole [PDF Version]
    [¹⁸F]FMISO
    The MICAD Research Team.
    Created: July 18, 2005; Last Update: August 15, 2005.
  - [¹⁸F]Fluoropropyl-Tanaproget [PDF Version]
    [¹⁸F]FPTP
    Kam Leung.
    Created: October 6, 2010; Last Update: December 11, 2010.
  - [¹⁸F]-Labeled (R)-(2-(2-(2-methylpyrrolidin-1-yl)ethyl)benzofuran-5-yl)(4-fluorophenyl)-methanone [PDF Version]
    [¹⁸F]9
    Liang Shan.
    Created: August 24, 2012; Last Update: September 25, 2012.
  - [¹⁸F]N-(2-benzofuranylmethyl)-N'-[4-(2-fluoroethoxy)benzyl]piperazine [PDF Version]
    [¹⁸F]6
    Liang Shan.
    Created: May 10, 2012; Last Update: June 27, 2012.
  - [¹⁸F]-N-(2-Chloro-6-methylphenyl)-2-(6-(4-(2-fluoroethyl)piperazin-1-yl)-2-methylpyrimidin-4-ylamino)thiazole-5-carboxamide [PDF Version]
    [¹⁸F]SKI-249380
    Kam Leung.
    Created: August 30, 2008; Last Update: October 15, 2008.
  - [¹⁸F]-N-{4-[(4,5-Dichloro-2-fluorophenyl)amino]quinazoline-6-yl}-dimethylamine-butylamide [PDF Version]
    [¹⁸F]ML04
    Arvind Chopra.
    Created: June 26, 2009; Last Update: August 12, 2009.
  - [¹⁸F]Norchloro-fluoro-homoepibatidine [PDF Version]
    [¹⁸F]NCFHEB
    Kam Leung.
    Created: August 12, 2008; Last Update: August 22, 2008.
  - [¹⁸F]SB209670 [PDF Version]
    The MICAD Research Team.
    Created: March 17, 2007; Last Update: March 25, 2007.
  - [¹⁸F]Y1-973 [PDF Version]
    [¹⁸F]Y1-973
    Kam Leung.
    Created: October 30, 2012; Last Update: February 14, 2013.
  - [¹⁸F]α/γ-Fluorobenzylamine-folate [PDF Version]
    [¹⁸F]α/γ-FBA-folate
    Kam Leung.
    Created: July 12, 2006; Last Update: August 7, 2006.
  - [2-[¹⁸F]Fluoromethoxy-5-(5-trifluoromethyl-tetrazol-1-yl)-benzyl]([2S,3S]2-phenyl-piperidin-3-yl)-amine [PDF Version]
    [¹⁸F]SPA-RQ
    The MICAD Research Team.
    Created: June 21, 2006; Last Update: July 10, 2006.
  - 1-(2,3-Dihydrobenzo[b][1,4]dioxin-6-yl)-4-((6-[¹⁸F]fluoropyridin-3-yl)methyl)piperazine [PDF Version]
    [¹⁸F]3d
    Kam Leung.
    Created: May 10, 2013; Last Update: June 13, 2013.
  - 1-(2'-Deoxy-2'-[¹⁸F]fluoroarabinofuranosyl)cytosine [PDF Version]
    [¹⁸F]FAC
    Kam Leung.
    Created: December 18, 2010; Last Update: March 9, 2011.
  - 1-(2'-Deoxy-2'-[¹⁸F]fluoro-β-d-arabinofuranosyl)-5-iodocytosine [PDF Version]
    ¹⁸F-FIAC
    Liang Shan.
    Created: March 19, 2012; Last Update: April 11, 2012.
  - 1-(2-[¹⁸F]Fluoro-3-pyridyl)-4-(2-isopropyl-1-oxo-isoindoline-5-yl)-5-methyl-1H-1,2,3-triazole [PDF Version]
    [¹⁸F]FPIT
    Kam Leung.
    Created: November 15, 2012; Last Update: March 7, 2013.
  - 1-(2-[¹⁸F]Fluoro-3-pyridyl)-4-(2-propyl-1-oxo-isoindoline-5-yl)-5-methyl-1H-1,2,3-triazole [PDF Version]
    [¹⁸F]MK-1312
    Kam Leung.
    Created: November 8, 2012; Last Update: March 7, 2013.
  - 1-(2-{(2R)-1-[(2-[¹⁸F]Fluorophenyl)sulfonyl]pyrrolidin-2-yl}ethyl)-4-methylpiperidine [PDF Version]
    [¹⁸F]-2FP3
    Kam Leung.
    Created: July 20, 2012; Last Update: November 1, 2012.
  - 1-(2’-Deoxy-2’-[¹⁸F]-fluoro-β-D-arabinofuranosyl)thymine [PDF Version]
    [¹⁸F]FMAU
    Arvind Chopra.
    Created: January 9, 2008; Last Update: February 14, 2008.
  - 1-(4-[¹⁸F]Fluoroethoxy-3-methoxyphenethyl)-4-(3-phenylpropyl)piperazine [PDF Version]
    [¹⁸F]FE-SA4503
    Kenneth T. Cheng.
    Created: May 5, 2006; Last Update: May 27, 2008.
  - 1-(4-[¹⁸F]Fluoromethoxy-3-methoxyphenethyl)-4-(3-phenylpropyl)piperazine [PDF Version]
    [¹⁸F]FM-SA4503
    Kenneth T. Cheng.
    Created: June 7, 2007; Last Update: February 6, 2008.
  - 1-(5-[¹⁸F]Fluoro-5-deoxy-α-D-arabinofuranosyl)-2-nitroimidazole [PDF Version]
    [¹⁸F]FAZA
    Kam Leung.
    Created: July 19, 2005; Last Update: December 27, 2009.
  - 1-[¹⁸F]Fluoro-3,6-dioxatetracosane [PDF Version]
    [¹⁸F]SteP2
    Arvind Chopra.
    Created: March 31, 2009; Last Update: May 20, 2009.
  - 1-[4-(2-[¹⁸F]Fluoroethoxy)-benzyl]-5-(2-phenoxymethyl-pyrrolidine-1-sulfonyl)-1H-indole-2,3-dione [PDF Version]
    [¹⁸F]WC-II-89
    Kam Leung.
    Created: June 28, 2007; Last Update: February 16, 2008.
  - 1-[4-(3-[¹⁸F]Fluoropropoxy)-3-methoxyphenyl]-5-hydroxy-7-(4-hydroxy-3-methoxyphenyl)-1,4,6-heptatrien-3-one [PDF Version]
    [¹⁸F]Fluoropropyl-substituted curcumin
    The MICAD Research Team.
    Created: October 17, 2006; Last Update: October 24, 2006.
  - ¹¹C-BMS-5p and ¹⁸F-FBzBMS: radiolabeled analogs of BMS-207940, a potent and selective antagonist of endothelin receptor subtype A [PDF Version]
    [¹¹C]-BMS-5p and [¹⁸F]FBzBMS
    Arvind Chopra.
    Created: March 12, 2013; Last Update: June 27, 2013.
  - 16α-[¹⁸F]Fluoro-17β-estradiol [PDF Version]
    [¹⁸F]FES
    Kam Leung.
    Created: December 6, 2004; Last Update: June 6, 2008.
  - 18-[¹⁸F]Fluoro-4-thia-oleate [PDF Version]
    [¹⁸F]FTO
    Kam Leung.
    Created: September 15, 2010; Last Update: December 22, 2010.
  - 18-[¹⁸F]Fluoro-4-thia-palmitate [PDF Version]
    [¹⁸F]FTP
    Kam Leung.
    Created: October 15, 2010; Last Update: December 22, 2010.
  - ¹⁸F-(2S,4R)4-fluoroglutamine [PDF Version]
    [¹⁸F]4-FGln
    Arvind Chopra.
    Created: December 15, 2011; Last Update: January 26, 2012.
  - ¹⁸F-1,4,7-Triazacyclononane-1,4,7-triacetic acid-10-maleimidoethylacetamide-Affibody Z_HER2:2395 [PDF Version]
    ¹⁸F-NOTA-Z_HER2:2395
    Kam Leung.
    Created: January 16, 2012; Last Update: March 29, 2012.
  - ¹⁸F-6-Fluoro-N-[2-(diethylamino)ethyl]pyridine-3-carboxamide [PDF Version]
    ¹⁸F-MEL050
    Liang Shan.
    Created: August 5, 2011; Last Update: September 28, 2011.
  - ¹⁸F-Fluoroethyl triazole-βAG-[(d)-Phe¹-c(Cys²-Tyr³-(d)-Trp⁴-Lys⁵-Thr⁶-Cys⁷)Thr⁸] [PDF Version]
    ¹⁸F-FET-βAG-TOCA
    Liang Shan.
    Created: March 7, 2012; Last Update: March 28, 2012.
  - ¹⁸F-Labeled 4-(5-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N,N-dimethylbenzenamine [PDF Version]
    [¹⁸F]FPHBF-1
    Liang Shan.
    Created: January 2, 2012; Last Update: March 7, 2012.
  - ¹⁸F-Labeled 5-(5-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N,N-dimethylpyridin-2-amine [PDF Version]
    [¹⁸F]FPYBF-1
    Liang Shan.
    Created: January 2, 2012; Last Update: March 7, 2012.
  - ¹⁸F-Labeled 6-amino-2-(4’-fluorophenyl)-1,3-benzothiazole and other derivatives [PDF Version]
    [¹⁸F]2
    Arvind Chopra.
    Created: November 23, 2009; Last Update: January 7, 2010.
  - ¹⁸F-Labeled 6-methyl-2-(4’-fluorophenyl)-1,3-benzothiazole [PDF Version]
    [¹⁸F]5
    Arvind Chopra.
    Created: December 4, 2009; Last Update: January 7, 2009.
  - ¹⁸F-Labeled Cys-Z_HER2:342, an anti-epidermal growth factor receptor-2 Affibody [PDF Version]
    [¹⁸F]-Cys-Z_HER2:342
    Arvind Chopra.
    Created: July 3, 2012; Last Update: August 9, 2012.
  - ¹⁸F-Labeled exendin(9-39) [PDF Version]
    [¹⁸F]Ex(9-39)
    Arvind Chopra.
    Created: February 9, 2012; Last Update: May 17, 2012.
  - ¹⁸F-Labeled fluoropegylated 6-fluoroethoxy-4'-dimethylaminoflavone, 6-(2-(2-fluoro-ethoxy)-ethoxy)-4'-dimethylaminoflavone, and 6-(2-(2-(2-fluoro-ethoxy)-ethoxy)ethoxy)-4'-dimethylaminoflavone [PDF Version]
    [¹⁸F]8(a–c)
    Liang Shan.
    Created: November 30, 2011; Last Update: December 28, 2011.
  - ¹⁸F-Labeled N-(4-(6,7-dimethoxy-3,4-dihydroisoquinolin-2(1H)-yl)butyl)-2-(2-[¹⁸F]-fluoroethoxy)-5-iodo-3-methoxybenzamide [PDF Version]
    [¹⁸F]3f
    Arvind Chopra.
    Created: November 18, 2009; Last Update: January 7, 2010.
  - ¹⁸F-Labeled N-(4-(6,7-dimethoxy-3,4-dihydroisoquinolin-2(1H)-yl)butyl)-2-(2-fluoroethoxy)-5-methylbenzamide [PDF Version]
    [¹⁸F]3c
    Arvind Chopra.
    Created: November 18, 2009; Last Update: January 7, 2010.
  - ¹⁸F-Labeled N-(4-fluorobenzylidene)oxime-dimeric (Z_HER2:477)₂ [PDF Version]
    ¹⁸F-FBO-(Z_HER2:477)₂
    Liang Shan.
    Created: November 2, 2011; Last Update: January 4, 2012.
  - ¹⁸F-Labeled N-(4-fluorobenzylidene)oxime-monomeric Z_HER2:477 [PDF Version]
    ¹⁸F-FBO-Z_HER2:477
    Liang Shan.
    Created: November 2, 2011; Last Update: January 4, 2012.
  - ¹⁸F-Labeled N-(4-fluorobenzylidene)oxime-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH₂ with a disulfide bridge between the two homoC [PDF Version]
    ¹⁸F-FBO-MUT-DS
    Liang Shan.
    Created: November 15, 2011; Last Update: January 4, 2012.
  - ¹⁸F-Labeled neogalactosylalbumin [PDF Version]
    [¹⁸F]FNGA
    Arvind Chopra.
    Created: October 19, 2009; Last Update: November 12, 2009.
  - ¹⁸F-Labeled N-succinimidyl-4-fluorobenzoate–conjugated rat anti-mouse vascular endothelial growth factor receptor 2 monoclonal antibody linked to microbubbles [PDF Version]
    [¹⁸F]-4SFB-Avas12a1 MB
    Arvind Chopra.
    Created: November 14, 2011; Last Update: March 15, 2012.
  - ¹⁸F-Labeled poly(L-lactic acid)-block-poly(sarcosine) lactosome, a polymer micelle [PDF Version]
    [¹⁸F]-Lactosome
    Arvind Chopra.
    Created: April 5, 2013; Last Update: May 2, 2013.
  - ¹⁸F-Tetrazine-trans-cyclooctene-Cys⁴⁰-exendin-4 [PDF Version]
    ¹⁸F-TTCO-Cys⁴⁰-exendin-4
    Kam Leung.
    Created: February 18, 2013; Last Update: April 25, 2013.
  - 1-Deoxy-1-[¹⁸F]fluoro-scyllo-inositol [PDF Version]
    [¹⁸F]-scyllo-Inositol
    Kam Leung.
    Created: December 7, 2011; Last Update: March 22, 2012.
  - 1-O-(4-(2-[¹⁸F]Fluoroethyl-carbamoyloxymethyl)-2-nitrophenyl)-O-β-d-glucopyronuronate [PDF Version]
    [¹⁸F]FEAnGA
    Arvind Chopra.
    Created: March 28, 2012; Last Update: April 27, 2012.
  - 2´-Deoxy-2´-[¹⁸F]fluoro-5-fluoro-1-β-D-arabinofuranosyluracil [PDF Version]
    [¹⁸F]FFAU
    The MICAD Research Team.
    Created: October 3, 2006; Last Update: October 16, 2006.
  - 2'-Deoxy-2'-[¹⁸F]fluoro-1-β-D-arabinofuranosyl-adenine [PDF Version]
    [¹⁸F]FAA
    Kam Leung.
    Created: September 11, 2007; Last Update: October 29, 2007.
  - 2-((2-Amino-4-chloro-5-[¹⁸F]fluorophenyl)thio)-N,N-dimethylbenzenmethanamine [PDF Version]
    [¹⁸F]ACF
    The MICAD Research Team.
    Created: February 13, 2006; Last Update: February 27, 2006.
  - 2-(+/-)-2-exo-(2'-[¹⁸F]Fluoro-3'-phenyl-pyridin-5'-yl)-7-azabicyclo[2.2.1]heptane [PDF Version]
    [¹⁸F]FPhEP
    Kam Leung.
    Created: October 6, 2006; Last Update: December 4, 2006.
  - 2-(1-{6-[(2-[¹⁸F]Fluoroethyl)(methyl)amino]-2-naphthyl}ethylidene)malononitrile [PDF Version]
    [¹⁸F]FDDNP
    Kam Leung.
    Created: July 25, 2005; Last Update: June 26, 2011.
  - 2-(2'-((Dimethylamino)methyl)-4'-(3-[¹⁸F]fluoropropoxy)-phenylthio)benzenamine [PDF Version]
    [¹⁸F]SERT-1
    Kam Leung.
    Created: September 24, 2008; Last Update: December 2, 2008.
  - 2-(2-(2-(4-((4-(Methylamino)phenyl)ethynyl)phenoxy)ethoxy)[¹⁸F]fluoroethoxy)ethyl-4-methylbenzenamine [PDF Version]
    [¹⁸F]AV-138
    Kam Leung.
    Created: May 11, 2011; Last Update: July 28, 2011.
  - 2-(2-Nitro-1H-imidazol-1-yl)ethyl 2-[¹⁸F]fluoroacetate [PDF Version]
    [¹⁸F]NEFT
    Kam Leung.
    Created: July 19, 2011; Last Update: October 13, 2011.
  - 2-(2-Nitro-1H-imidazol-1-yl)-N-(2,2,3,3,3-[¹⁸F]pentafluoropropyl)-acetamide [PDF Version]
    [¹⁸F]EF5
    The MICAD Research Team.
    Created: November 8, 2005; Last Update: December 31, 2005.
  - 2-(2-Nitroimidazol-1H-yl)-(3-[¹⁸F]fluoropropyl)acetamide [PDF Version]
    [¹⁸F]EF1
    The MICAD Research Team.
    Created: November 5, 2005; Last Update: November 17, 2005.
  - 2-(3-{1-Carboxy-5-[(6-[¹⁸F]fluoro-pyridine-3-carbonyl)-amino]-pentyl}-ureido)-pentanedioic acid [PDF Version]
    [¹⁸F]DCFPyL
    Liang Shan.
    Created: November 10, 2012; Last Update: December 19, 2012.
  - 2-(4-(2-[¹⁸F]Fluoroethyl)piperidin-1-yl)benzo[4,5]imidazo[1,2-a]pyrimidine [PDF Version]
    [¹⁸F]T808
    Kam Leung.
    Created: September 27, 2012; Last Update: December 12, 2012.
  - 2-(4-(4-[¹⁸F]Fluoro-butyl)-benzylsulfanyl)-3-methyl-chromen-4-one [PDF Version]
    [¹⁸F]RP1005
    Kam Leung.
    Created: June 15, 2011; Last Update: January 26, 2012.
  - 2-(4-Aminophenyl)-6-(2-([¹⁸F]fluoroethoxy))quinoline [PDF Version]
    [¹⁸F]THK523
    Kam Leung.
    Created: June 27, 2011; Last Update: September 29, 2011.
  - 2-(5-[¹⁸F]Fluoro-pentyl)-2-methyl-malonic acid (ML-10) [PDF Version]
    [¹⁸F]ML-10
    Arvind Chopra.
    Created: August 15, 2012; Last Update: September 27, 2012.
  - 2-(6-Chloro-2-(4-(3-[¹⁸F]fluoropropoxy)phenyl)imidazo[1,2-a]pyridin-3-yl)-N,N-diethylacetamide [PDF Version]
    [¹⁸F]PBR111
    Kam Leung.
    Created: December 6, 2008; Last Update: March 11, 2009.
  - 2-[(2-chloro-2’-¹⁸F-fluorodiethyl)amino]-2H-1,3,2-oxazaphosphorinane-2-oxide [PDF Version]
    ¹⁸F-F-CP
    Arvind Chopra.
    Created: December 21, 2007; Last Update: January 24, 2008.
  - 2-[(4-{[(2-amino-4-oxohydropteridin-7yl)methyl]amino}phenyl) carbonylamino]-4-{N-[(2-[18F]-fluoro(4-pyridyl))carbonylamino] carbamoyl}butanoic acid [PDF Version]
    [¹⁸F]-Folate-2
    Arvind Chopra.
    Created: November 16, 2011; Last Update: December 26, 2011.
  - 2-[(4-{[(2-amino-4-oxohydropteridin-7yl)methyl]amino}phenyl) carbonylamino]-4-{N-[(4-[¹⁸F]-fluorophenyl)carbonylamino] carbamoyl}butanoic acid [PDF Version]
    [¹⁸F]-Folate-1
    Arvind Chopra.
    Created: November 16, 2011; Last Update: December 26, 2011.
  - 2-[¹⁸F]Fluoro-3-[2-((S)-3-pyrrolinyl)methoxy]pyridine [PDF Version]
    [¹⁸F]Nifene
    Kam Leung.
    Created: September 6, 2006; Last Update: October 2, 2006.
  - 2-[¹⁸F]Fluoro-3-[2(S)-2-azetidinylmethoxy]pyridine [PDF Version]
    2-[¹⁸F]FA
    Kam Leung.
    Created: June 23, 2006; Last Update: April 8, 2008.
  - 2-[¹⁸F]Fluoroacetate [PDF Version]
    [¹⁸F]FAC
    Kam Leung.
    Created: March 22, 2007; Last Update: June 24, 2008.
  - 2-[¹⁸F]Fluoro-N-(2-(2-nitro-1H-imidazol-1-yl)ethyl)acetamide [PDF Version]
    [¹⁸F]NEFA
    Kam Leung.
    Created: July 19, 2011; Last Update: October 13, 2011.
  - 2-[¹⁸F]Fluoropropionyl-osteosarcoma–specific peptide-1 (ASGALSPSRLDT) [PDF Version]
    [¹⁸F]FP-OSP-1
    Kam Leung.
    Created: September 23, 2010; Last Update: January 7, 2011.
  - 2-[¹⁸F]Fluoropyridine-4-carbohydrazide-methotrexate [PDF Version]
    [¹⁸F]-Folate-MTX-9
    Arvind Chopra.
    Created: November 16, 2011; Last Update: December 26, 2011.
  - 2-[4-(4-[¹⁸F]Fluorobutyl)benzylsulfanyl]-3-methylchromene-4-one [PDF Version]
    [¹⁸F]10
    Kam Leung.
    Created: December 15, 2007; Last Update: January 24, 2012.
  - 2-{3-[¹⁸F]Fluoro-4-(methylamino)phenyl}-1,3-benzothiazol-6-ol [PDF Version]
    [¹⁸F]Flutemetamol
    Arvind Chopra.
    Created: November 14, 2012; Last Update: December 27, 2012.
  - 2-{4-[-Pyridin-4-yl-1-(2-[¹⁸F]fluoro-ethyl)-1H-pyrazol-3-yl]-phenoxymethyl}-quinoline [PDF Version]
    [¹⁸F]JNJ41510417
    Kam Leung.
    Created: December 20, 2010; Last Update: March 2, 2011.
  - 2-Deoxy-2-[¹⁸F]fluorosorbitol [PDF Version]
    [¹⁸F]FDS
    Arvind Chopra.
    Created: January 14, 2008; Last Update: February 6, 2008.
  - 2-tert-Butyl-4-chloro-5-[4-(2-[¹⁸F]fluoroethoxymethyl)-benzyloxy]-2H-pyridazin-3-one [PDF Version]
    BMS-747158-02
    Kam Leung.
    Created: December 15, 2007; Last Update: January 24, 2012.
  - 2-tert-Butyl-4-chloro-5-[4-(2-[¹⁸F]fluoro-ethoxymethyl)-benzyloxy]-3-(2H)-pyridazinone [PDF Version]
    [¹⁸F]MC1-27
    Kam Leung.
    Created: May 15, 2010; Last Update: July 29, 2010.
  - 2-tert-Butyl-4-chloro-5-[4-(4-[¹⁸F]fluoro-butyl)-benzyloxy]-2H-pyridazin-3-one [PDF Version]
    [¹⁸F]RP1004
    Kam Leung.
    Created: June 15, 2010; Last Update: August 26, 2010.
  - 2β-Carbo(2-[¹⁸F]fluoroethoxy)-3β-(3´-((Z)-2-iodoethenyl)phenyl)nortropane [PDF Version]
    [¹⁸F]FEmZIENT
    Jeffrey Stehouwer and Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - 2β-Carbo(2-[¹⁸F]fluoroethoxy)-3β-(4´-((Z)-2-iodoethenyl)phenyl)nortropane [PDF Version]
    [¹⁸F]FEpZIENT
    Jeffrey Stehouwer and Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - 2β-Carbomethoxy-3β-(4-chlorophenyl)-8-(2-[¹⁸F]fluoroethyl)nortropane [PDF Version]
    [¹⁸F]FECNT
    Kam Leung.
    Created: October 27, 2005; Last Update: January 15, 2008.
  - 2’-[¹⁸F]Fluoroflumazenil [PDF Version]
    [¹⁸F]FFMZ
    The MICAD Research Team.
    Created: December 19, 2005; Last Update: December 17, 2005.
  - 2’-[¹⁸F]Fluorofolic acid [PDF Version]
    2’-[¹⁸F]FFA
    Kam Leung.
    Created: December 6, 2010; Last Update: March 9, 2011.
  - 3'-Aza-2'-[¹⁸F]fluorofolic acid [PDF Version]
    3'-Aza-2'-[¹⁸F]FFA
    Kam Leung.
    Created: April 6, 2013; Last Update: June 6, 2013.
  - 3'-Deoxy-3'-[¹⁸F]fluoro-1-β-D-xylofuranosyl-adenine [PDF Version]
    [¹⁸F]FXA
    Kam Leung.
    Created: September 11, 2007; Last Update: October 29, 2007.
  - 3'-Deoxy-3'-[¹⁸F]fluorothymidine [PDF Version]
    [¹⁸F]FLT
    Kam Leung.
    Created: October 1, 2004; Last Update: January 15, 2005.
  - 3-(2-(S)-3,4-Dehydropyrrolinyl methoxy)-5-(3'-[¹⁸F]fluoropropyl)pyridine [PDF Version]
    [¹⁸F]Nifrolene
    Kam Leung.
    Created: March 18, 2013; Last Update: May 23, 2013.
  - 3-(3-(3-[¹⁸F]Flouropropyl)thio)-1,2,5-thiadiazol-4-yl)-1,2,5,6-tetrahydro-1-methylpyridine [PDF Version]
    [¹⁸F]FP-TZTP
    Kam Leung.
    Created: May 25, 2005; Last Update: June 6, 2005.
  - 3-(4-[¹⁸F]Fluorobenzyl)-8-methoxy-1,2,3,4 tetrahydrochromeno[3,4-c]pyridin-5-one [PDF Version]
    [¹⁸F]FMTP
    Kam Leung.
    Created: December 5, 2005; Last Update: February 7, 2012.
  - 3-(Pyridin-2-ylethynyl)-cyclohex-2-enone-O-[¹⁸F]fluoroethyl-oxime [PDF Version]
    [¹⁸F]FE-DABP688
    Kam Leung.
    Created: December 3, 2007; Last Update: January 28, 2008.
  - 3-[2-[4-(4-[¹⁸F]Fluorobenzoyl)-1-piperidyl]ethyl]-2-sulfanyl-3H-quinazolin-4-one [PDF Version]
    [¹⁸F]Altanserin
    Kam Leung.
    Created: December 8, 2005; Last Update: May 29, 2008.
  - 3-{4-[2-[Benzoxazol-2-yl-methylamino]ethoxy]phenyl}-2-(2-[¹⁸F]fluoroethoxy)propionic acid [PDF Version]
    Compound [¹⁸F]22
    The MICAD Research Team.
    Created: April 2, 2007; Last Update: May 15, 2007.
  - 3-Chloro-4-[¹⁸F]fluorophenyl-(4-fluoro-4-[[((5-methyl-4-methylamino-pyridin-2-ylmethyl)-amino]-methyl]-piperidin-1-yl)methanone (F13714) [PDF Version]
    [¹⁸F]F13714
    Kam Leung.
    Created: June 24, 2012; Last Update: October 11, 2012.
  - 3-Chloro-4-[¹⁸F]fluorophenyl-(4-fluoro-4-[[(5-methyl-pyrimidin-2-ylmethyl)-amino]-methyl]-piperidin-1-yl)methanone (F15599) [PDF Version]
    [¹⁸F]F15599
    Kam Leung.
    Created: June 20, 2012; Last Update: October 11, 2012.
  - 3-Cyano-4-[¹⁸F]fluoro-benzoyl-Ala(SO₃H)-Ala(SO₃H)-Ava-Gln-Trp-Ala-Val-NMeGly-His-Sta-Leu-NH₂ [PDF Version]
    [¹⁸F]BAY 86-4367
    Kam Leung.
    Created: June 5, 2011; Last Update: August 25, 2011.
  - 3-Cyano-4-[¹⁸F]fluoro-benzoyl-Ala(SO₃H)-Ava-Gln-Trp-Ala-Val-NMeGly-His-Sta-Leu-NH₂ [PDF Version]
    [¹⁸F]7b
    Liang Shan.
    Created: December 20, 2010; Last Update: January 24, 2011.
  - 3-Cyano-4-[¹⁸F]fluoro-benzoyl-Arg-Ava-Gln-Trp-Ala-Val-NMeGly-His-Sta-Leu-NH₂ [PDF Version]
    [¹⁸F]6b
    Liang Shan.
    Created: December 20, 2010; Last Update: January 24, 2011.
  - 3-N-(2-[¹⁸F]Fluoroethyl)spiperone [PDF Version]
    [¹⁸F]FESP
    Kam Leung.
    Created: October 7, 2005; Last Update: January 18, 2012.
  - 3-β-(4-Iodophenyl)tropane-2-β-carboxylic acid 2-[¹⁸F]fluoroethyl ester [PDF Version]
    [¹⁸F]FE@CIT
    Kam Leung.
    Created: August 11, 2008; Last Update: September 17, 2008.
  - 4,16α-[16α-¹⁸F]Difluoro-11β-methoxyestradiol [PDF Version]
    4F-M[¹⁸F]FES
    Kam Leung.
    Created: August 6, 2009; Last Update: September 12, 2009.
  - 4-(2´-Methoxyphenyl)-1-[2´-(N-2´´-1,3 pyrimidino)-p-[¹⁸F]fluorobenzamido]ethylpiperazine [PDF Version]
    [¹⁸F]FPWAY
    Kenneth T. Cheng.
    Created: February 1, 2005; Last Update: June 30, 2008.
  - 4-(2´-Methoxyphenyl)-1-[2´-(N-2´´-pyridinyl)-p-[¹⁸F]fluorobenzamido]ethylpiperazine [PDF Version]
    p-[¹⁸F]MPPF
    Kenneth T. Cheng.
    Created: December 20, 2005; Last Update: March 10, 2008.
  - 4-(2-(4-(4-[¹⁸F]Fluoro-butyl)-phenyl)ethoxy) quinazoline [PDF Version]
    [¹⁸F]RP1003
    Kam Leung.
    Created: June 15, 2011; Last Update: January 26, 2012.
  - 4-(3-((5-(2-[¹⁸F]Fluoroethoxy)pyridine-2-yl)oxy)benzylidene)-N-(pyridazin-3-yl)piperidine-1-carboxamide [PDF Version]
    [¹⁸F]PF-9811
    Kam Leung.
    Created: October 20, 2012; Last Update: February 7, 2013.
  - 4-[¹⁸F]Fluoro-2-D-methyl-3-mercaptopropanoyl-L-proline [PDF Version]
    [¹⁸F]FCAP
    Arvind Chopra.
    Created: March 8, 2007; Last Update: January 2, 2008.
  - 4-[¹⁸F]Fluorobenzenecarbohydrazide-methotrexate [PDF Version]
    [¹⁸F]-Folate-MTX-8
    Arvind Chopra.
    Created: November 16, 2011; Last Update: December 26, 2011.
  - 4-[¹⁸F]Fluorobenzoyl-annexin V [PDF Version]
    4-[¹⁸F]FBA
    Kam Leung.
    Created: February 7, 2006; Last Update: March 27, 2008.
  - 4-[¹⁸F]Fluorobenzoyl-Arg-Arg-Natl-Cys-Tyr-Cit-Lys-d-Lys-Pro-Tyr-Arg-Cit-Cys-Arg-NH₂ [PDF Version]
    4-[¹⁸F]F-T140
    Kam Leung.
    Created: January 15, 2011; Last Update: March 23, 2011.
  - 4-[¹⁸F]Fluorobenzoyl-C2A domain of synaptotagmin I-glutathione-S-transferase [PDF Version]
    4-[¹⁸F]FB-C2A-GST
    Kam Leung.
    Created: May 27, 2011; Last Update: August 4, 2011.
  - 4-[¹⁸F]Fluorobenzoyl-endothelin-1 [PDF Version]
    [¹⁸F]ET-1
    The MICAD Research Team.
    Created: March 12, 2007; Last Update: April 12, 2007.
  - 4-[¹⁸F]Fluorobenzoyl-knottin 2.5D [PDF Version]
    [¹⁸F]FB-2.5D
    Kam Leung.
    Created: March 23, 2010; Last Update: September 23, 2010.
  - 4-[¹⁸F]Fluorobenzoyl-NAVPNLRGDLQVLAQKVART [PDF Version]
    [¹⁸F]FB-A20FMDV2
    Kam Leung.
    Created: March 16, 2008; Last Update: May 12, 2008.
  - 4-[¹⁸F]Fluorobenzoyl-Phe-Ala-Leu-Gly-Glu-Ala-NH₂ [PDF Version]
    [¹⁸F]FBA-FALGEA-NH₂
    Kam Leung.
    Created: August 26, 2011; Last Update: December 8, 2011.
  - 4-[¹⁸F]Fluorobenzoyl-rhenium-cyclized-Ac-D-Lys-[Cys^3,4,10, D-Phe⁷, Arg¹¹]α-MSH_3-13 [PDF Version]
    [¹⁸F]FB-RMSH
    Kam Leung.
    Created: February 20, 2010; Last Update: April 8, 2010.
  - 4-[¹⁸F]Fluorobenzoyl-T84.66 diabody [PDF Version]
    [¹⁸F]FB-T84.66 diabody
    Kam Leung.
    Created: April 15, 2007; Last Update: February 1, 2008.
  - 4-[¹⁸F]Fluorobenzoyl-ε-Lys¹-c(KRGDe)MDDPGRNPHhCitGPAT [PDF Version]
    [¹⁸F]FB-RGDechi-hCit
    Kam Leung.
    Created: November 26, 2009; Last Update: December 17, 2009.
  - 4-[¹⁸F]Fluorobenzyl-triphenylphosphonium [PDF Version]
    [¹⁸F]FBnTP
    Kam Leung.
    Created: September 26, 2006; Last Update: January 2, 2008.
  - 4-[¹⁸F]Fluoro-l-m-tyrosine [PDF Version]
    4-[¹⁸F]FMT
    The MICAD Research Team.
    Created: October 11, 2006; Last Update: November 9, 2006.
  - 4-[¹⁸F]Fluoro-N-[4-[6-(isopropylamino)pyrimidin-4-yl]-1,3-thiazol-2-yl]-N-methylbenzamide [PDF Version]
    [¹⁸F]FITM
    Kam Leung.
    Created: November 5, 2012; Last Update: February 14, 2013.
  - 4-[¹⁸F]Fluoropaclitaxel [PDF Version]
    [¹⁸F]FPAC
    Kam Leung.
    Created: January 2, 2006; Last Update: February 14, 2012.
  - 4-[5-(4-[¹⁸F]Fluoro-phenyl)-[1,3,4]oxadiazol-2-yl]-1,4-diaza-bicyclo[3.2.2]nonane [PDF Version]
    [¹⁸F]NS10743
    Kam Leung.
    Created: December 12, 2010; Last Update: January 27, 2011.
  - 4-Bromo-1-(3-[¹⁸F]fluoropropyl)-2-nitroimidazole [PDF Version]
    4-Br[¹⁸F]FPN
    The MICAD Research Team.
    Created: October 27, 2005; Last Update: December 12, 2005.
  - 5-(2-[¹⁸F]Fluoroethoxy)-L-tryphan [PDF Version]
    [¹⁸F]-L-FEHTP
    Kam Leung.
    Created: March 3, 2012; Last Update: June 28, 2012.
  - 5-(5-(2-(2-(2-[¹⁸F]Fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N-methylbenzenamine [PDF Version]
    [¹⁸F]FPHBF-2
    Kam Leung.
    Created: June 11, 2011; Last Update: September 1, 2011.
  - 5-(5-(2-(2-(2-[¹⁸F]Fluoroethoxy)ethoxy)ethoxy)benzofuran-2-yl)-N-methylpyridin-2-amine [PDF Version]
    [¹⁸F]FPYBF-2
    Kam Leung.
    Created: June 11, 2011; Last Update: September 1, 2011.
  - 5-[(E)-2-(4-[¹⁸F]Fluorophenyl)ethenyl]-1,3-benzenediol [PDF Version]
    3,5-Dihydroxy-4'-[¹⁸F]fluoro-trans-stilbene
    The MICAD Research Team.
    Created: August 22, 2006; Last Update: September 11, 2006.
  - 5-[¹⁸F]Fluoro-2-(1-methyl-1H-pyrrolo[2,3-b]pyridin-5-yl)-oxazolo[5,4-b]pyridine [PDF Version]
    [¹⁸F]MK-3328
    Arvind Chopra.
    Created: December 20, 2011; Last Update: February 16, 2012.
  - 5-3’-[¹⁸F]Fluoropropyl-3-[2-((S)-pyrrolidinyl)methoxy]pyridine [PDF Version]
    [¹⁸F]Nifrolidine
    Kam Leung.
    Created: September 18, 2006; Last Update: April 3, 2012.
  - 6-(2-[¹⁸F]Fluoroethoxy)-2-[2-(4-methylaminophenyl)ethenyl]benzoxazole [PDF Version]
    [¹⁸F]BF-168
    Kenneth T. Cheng.
    Created: October 3, 2006; Last Update: January 28, 2008.
  - 6-(3'-[¹⁸F]Fluoropropyl)-2-(4'-dimethylamino)phenylimidazol[1,2-α]pyridine [PDF Version]
    [¹⁸F]FPPIP
    Kenneth T. Cheng.
    Created: October 3, 2006; Last Update: April 9, 2008.
  - 6-[1-(2-[¹⁸F]Fluoro-3-pyridyl)-5-methyl-1H-1,2,3-triazol-4-yl]quinoline [PDF Version]
    [¹⁸F]FPTQ
    Kam Leung.
    Created: November 11, 2012; Last Update: March 7, 2013.
  - 6-[¹⁸F]Fluoro-3-[2(S)-2-azetidinylmethoxy]pyridine [PDF Version]
    6-[¹⁸F]FA
    Kam Leung.
    Created: June 26, 2006; Last Update: April 11, 2008.
  - 6-[¹⁸F]Fluorodopamine [PDF Version]
    [¹⁸F]FDA
    Kam Leung.
    Created: April 6, 2005; Last Update: December 29, 2011.
  - 6-[¹⁸F]Fluoro-l-m-tyrosine [PDF Version]
    6-[¹⁸F]FMT
    The MICAD Research Team.
    Created: May 22, 2006; Last Update: September 6, 2006.
  - 6-Deoxy-6-[¹⁸F]fluoro-D-fructose [PDF Version]
    6-[¹⁸F]FDF
    Kam Leung.
    Created: July 10, 2011; Last Update: October 27, 2011.
  - 6-Iodo-2-[4'-N-(2-[¹⁸F]fluoroethyl)methylamino]phenylimidazo[1,2-a]pyridine [PDF Version]
    [¹⁸F]FEM-IMPY
    The MICAD Research Team.
    Created: December 13, 2006; Last Update: December 31, 2006.
  - 6-O-(2-[¹⁸F]Fluoroethyl)-6-O-desmethyldiprenorphine [PDF Version]
    [¹⁸F]FDPN
    Kam Leung.
    Created: June 15, 2006; Last Update: May 27, 2008.
  - 8-Cyclopentyl-3-(3-[¹⁸F]fluoropropyl)-1-propylxanthine [PDF Version]
    [¹⁸F]CPFPX
    Kam Leung.
    Created: February 13, 2006; Last Update: July 8, 2006.
  - 9-(4-(2-[¹⁸F]Fluoroethyl)benzyl)-9-azabicyclo[3.3.1]nonan-3-yl-2-methoxy-5-methyl-phenylcarbamate [PDF Version]
    [¹⁸F]WC-59
    Arvind Chopra.
    Created: November 10, 2009; Last Update: December 9, 2009.
  - 9-(4-[¹⁸F]Fluoro-3-hydroxymethylbutyl)guanine [PDF Version]
    [¹⁸F]FHBG
    Kam Leung.
    Created: January 24, 2005; Last Update: February 23, 2005.
  - Ad5-(PSE-BC)-(GAL4-(VP16)₂)-(GAL4)₅-sr39tk [PDF Version]
    AdTSTA-sr39tk
    Huiming Zhang.
    Created: December 15, 2008; Last Update: January 5, 2009.
  - Al¹⁸F-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-Glu-[cyclo(Arg-Gly-Asp-d-Phe-Lys)]₂ [PDF Version]
    Al¹⁸F-NODAGA-E-[c(RGDfK)]₂
    Kam Leung.
    Created: May 7, 2013; Last Update: June 13, 2013.
  - Al¹⁸F-1,4,7-Triazacyclononane-1,4,7-diacetic acid-8-aminooctanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    Al¹⁸F-NOTA-8-Aoc-BBN[7-14]NH₂
    Kam Leung.
    Created: June 26, 2012; Last Update: October 4, 2012.
  - anti-1-Amino-2-[¹⁸F]fluorocyclobutane-1-carboxylic acid [PDF Version]
    anti-2-[¹⁸F]FACBC
    Kam Leung.
    Created: November 18, 2010; Last Update: February 10, 2011.
  - anti-1-Amino-3-[¹⁸F]fluorocyclobutane-1-carboxylic acid [PDF Version]
    anti-[¹⁸F]FACBC
    Kam Leung.
    Created: October 18, 2004; Last Update: October 21, 2010.
  - CtPyPyIm-(R)^H₂^Nγ-PyImPyPy-C₃-¹⁸F [PDF Version]
    [¹⁸F]PIPAM8
    Huiming Zhang.
    Created: November 4, 2008; Last Update: December 1, 2008.
  - Cyclo(-Arg-Gly-Asp-d-Phe-Lys(([¹⁸F]Fluoropropionyl)galacto-amino acid)-) [PDF Version]
    [¹⁸F]Galacto-RGD
    Kam Leung.
    Created: November 18, 2004; Last Update: January 9, 2006.
  - Cys-Arg-Pro-Pro-Arg-[¹⁸F]fluorodipalmitin-liposomes [PDF Version]
    CRPPR-[¹⁸F]FDP-liposomes
    Kam Leung.
    Created: May 12, 2008; Last Update: May 29, 2008.
  - Fluoro-pegylated (1E,4E)-1-(4-(dimethylamino)phenyl)-5-(4-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)phenyl)penta-1,4-dien-3-one and (1E,4E)-1-(4-(2-(2-(2-fluoroethoxy)ethoxy)ethoxy)phenyl)-5-(4-(methylamino)phenyl)penta-1,4-dien-3-one [PDF Version]
    [¹⁸F]83, [¹⁸F]85
    Liang Shan.
    Created: November 30, 2011; Last Update: February 7, 2012.
  - ImPyβImPyβImβ-C₃-¹⁸F [PDF Version]
    [¹⁸F]PIPAM5
    Huiming Zhang.
    Created: November 4, 2008; Last Update: December 1, 2008.
  - L-3,4-Dihydroxy-6-[¹⁸F]fluorophenylalanine [PDF Version]
    [¹⁸F]FDOPA
    Kam Leung.
    Created: March 21, 2005; Last Update: December 21, 2011.
  - L- and D-S-(3-[¹⁸F]fluoropropyl)homocysteine [PDF Version]
    l- and d-[¹⁸F]FPHCys
    Arvind Chopra.
    Created: January 10, 2012; Last Update: February 16, 2012.
  - m-Cyano-p-[¹⁸F]fluorohippurate [PDF Version]
    [¹⁸F]-CNPFH
    Arvind Chopra.
    Created: October 24, 2012; Last Update: November 21, 2012.
  - Methyl 2-(2-[¹⁸F]fluoro-4-nitrobenzamido)-3-methylbutanoate [PDF Version]
    [¹⁸F]MFNBMB
    Arvind Chopra.
    Created: August 5, 2009; Last Update: September 17, 2009.
  - Methyl 2-(2-[¹⁸F]fluoro-4-nitrobenzamido)-3- methylbutanoic acid [PDF Version]
    [¹⁸F]FNBMBA
    Arvind Chopra.
    Created: August 5, 2009; Last Update: September 17, 2009.
  - Methyl ester of 1-O-(4-(2-[¹⁸F]fluoroethyl-carbamoyloxymethyl)-2-nitrophenyl)-O-β-d-glucopyronuronate [PDF Version]
    [¹⁸F]FEAnGA-Me
    Arvind Chopra.
    Created: April 4, 2012; Last Update: April 27, 2012.
  - N-((E)-4-[¹⁸F]Fluorobut-2-en-1-yl)-2β-carbomethoxy-3β-(4'-fluorophenyl)nortropane [PDF Version]
    [¹⁸F]FBFNT
    Jeffrey S. Stehouwer and Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - N-(2-(1-(4-(2-Methoxyphenyl)piperazinyl)ethyl))-N-(2-(6-[¹⁸F]fluoro)-pyridinyl)cyclohexanecarboxamide [PDF Version]
    [¹⁸F]6FPWAY
    Kenneth T. Cheng.
    Created: December 29, 2005; Last Update: June 30, 2008.
  - N-(2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)ethyl)-4-[¹⁸F]-fluorobenzamide ([¹⁸F]FBEM) conjugated to EM3106B, an analog of glucagon-like peptide-1 [PDF Version]
    [¹⁸F]FBEM-EM3106B
    Arvind Chopra.
    Created: February 23, 2012; Last Update: March 22, 2012.
  - N-(2-(Diethylamino)ethyl)-6-[¹⁸F]fluoronicotinamide [PDF Version]
    [¹⁸F]2
    Kam Leung.
    Created: October 7, 2009; Last Update: February 24, 2010.
  - N-(2-Diethylaminoethyl)-4-[¹⁸F]fluorobenzamide for imaging melanoma [PDF Version]
    [¹⁸F]-DAFBA
    Liang Shan.
    Created: November 19, 2009; Last Update: December 30, 2009.
  - N-(3-[¹⁸F]Fluoropropyl)-2β-carbomethoxy-3β-(4-iodophenyl)nortropane [PDF Version]
    [¹⁸F]FP-CIT
    Kam Leung.
    Created: December 15, 2004; Last Update: February 1, 2011.
  - N-(4-(4-(2-(2-[¹⁸F]Fluoroethoxy)phenyl)piperazine-1-yl)butyl)-4-(3-thienyl)benzamide [PDF Version]
    [¹⁸F]5
    Kam Leung.
    Created: June 24, 2011; Last Update: October 6, 2011.
  - N-(4-[¹⁸F]Fluoro-benzoyl)-N'-{2-[5-(4-fluoro-benzyl)-1-(4-methoxy-benzyl)-4,6-dioxo-1,4,5,6-tetrahydro-[1,3,5]triazin-2-ylamino]-ethyl}-guanidine [PDF Version]
    [¹⁸F]PC-10
    Kam Leung.
    Created: June 29, 2011; Last Update: August 25, 2011.
  - N-(4-[¹⁸F]Fluorobenzyl)-4-(3-(piperidin-1-yl)indole-1-sulfonyl)benzamide [PDF Version]
    [¹⁸F]PipISB
    Kam Leung and Sean Donohue.
    Created: August 18, 2010; Last Update: October 28, 2010.
  - N-(5-Fluoro-2-phenoxyphenyl)-N-(2-[¹⁸F]fluoroethyl-5-methoxybenzyl)acetamide [PDF Version]
    [¹⁸F]FEDAA1106
    Kam Leung.
    Created: March 10, 2006; Last Update: March 27, 2008.
  - N-(6-[¹⁸F]Fluoro-4-phenoxypyridin-3-yl)-N-(2-methoxybenzyl)acetamide [PDF Version]
    6-[¹⁸F]Fluoro-PBR28
    Arvind Chopra.
    Created: March 26, 2013; Last Update: April 25, 2013.
  - N-[¹⁸F]Fluoroacetyl-N-(2,5-dimethoxybenzyl)-2-phenoxyaniline [PDF Version]
    [¹⁸F]PBR06
    Kam Leung.
    Created: June 6, 2007; Last Update: March 11, 2010.
  - N-[¹⁸F]Fluoroethylpiperidin-4ylmethyl acetate [PDF Version]
    [¹⁸F]FEP-4MA
    Kam Leung.
    Created: March 17, 2010; Last Update: September 23, 2010.
  - N-[2-(3-cyanophenyl)-3-(4-(2-[¹⁸F]fluorethoxy)phenyl)-1-methylpropyl]-2-(5-methyl-2-pyridyloxy)-2-methylproponamide [PDF Version]
    [¹⁸F]MK-9470
    Arvind Chopra.
    Created: February 28, 2008; Last Update: March 25, 2008.
  - N-[2-(4-[¹⁸F]Fluorobenzamido)ethyl]maleimide-Cys-Z_EGFR:1907 [PDF Version]
    [¹⁸F]FBEM-Cys-Z_EGFR:1907
    Kam Leung.
    Created: July 31, 2012; Last Update: November 1, 2012.
  - N-[2-(4-[¹⁸F]Fluorobenzamido)ethyl]maleimide-sulfhydryl-cyclic-arginine-glycine-aspartic acid dimeric peptide [PDF Version]
    [¹⁸F]FBEM-SRGD2
    Kenneth T. Cheng.
    Created: July 6, 2007; Last Update: February 25, 2008.
  - N-[2-(4-[¹⁸F]Fluorobenzamido)ethyl]maleimide-sulfhydryl-cyclic-arginine-glycine-aspartic acid peptide [PDF Version]
    [¹⁸F]FBEM-SRGD
    Kenneth T. Cheng.
    Created: July 6, 2007; Last Update: February 25, 2008.
  - N-[2-[N-Ethyl-N-[2-(2-[¹⁸F]fluoropyridin-3-yloxy)ethyl]amino]ethyl]-6-iodoquinoxaline-2-carboxamide [PDF Version]
    [¹⁸F]44
    Liang Shan.
    Created: August 5, 2011; Last Update: August 20, 2011.
  - N-[N-[(S)-1,3-Dicarboxypropyl]carbamoyl]-4-[¹⁸F]fluorobenzyl-L-cysteine [PDF Version]
    ¹⁸F-DCFBC
    Kam Leung.
    Created: November 1, 2008; Last Update: December 2, 2008.
  - N-{2-[4-(2-Methoxyphenyl)piperazinyl]ethyl}-N-(2-pyridyl)-N-(4-[¹⁸F]-fluoromethylcyclohexane)carboxamide [PDF Version]
    [¹⁸F]MeFWAY
    Kam Leung.
    Created: November 9, 2006; Last Update: April 11, 2012.
  - N-2-(4-[¹⁸F]-Fluorobenzamido)ethylmaleimide coupled to cysteine-tagged epidermal growth factor [PDF Version]
    [¹⁸F]FBEM-cEGF
    Arvind Chopra.
    Created: January 30, 2012; Last Update: March 29, 2012.
  - N-2-(4-[¹⁸F]-Fluorobenzamido)ethylmaleimide coupled to cysteine-tagged on the C- or N-terminal of exendin-4 [PDF Version]
    [¹⁸F]FBEM-[Cys⁰]-exendin-4 and [¹⁸F]FBEM-[Cys⁴⁰]-exendin-4
    Arvind Chopra.
    Created: February 21, 2012; Last Update: March 22, 2012.
  - N-4'-[¹⁸F]Fluorobenzylpiperidin-4yl-(2-fluorophenyl)acetamide [PDF Version]
    [¹⁸F]FBFPA
    Kam Leung.
    Created: October 6, 2006; Last Update: March 5, 2008.
  - N-4-[¹⁸F]Fluorobenzoyl-c(RGDyK) [PDF Version]
    [¹⁸F]FB-c(RGDyK)
    Kam Leung.
    Created: March 6, 2006; Last Update: March 11, 2008.
  - N-4-[¹⁸F]Fluorobenzoyl-c[(RGDyK)]₂ [PDF Version]
    [¹⁸F]FB-c[(RGDyK)]₂
    Kam Leung.
    Created: March 3, 2006; Last Update: March 6, 2008.
  - N-4-[¹⁸F]Fluorobut-2-yn-1-yl-2β-carbomethoxy-3β-phenyltropane [PDF Version]
    [¹⁸F]PR04.MZ
    Kam Leung.
    Created: August 10, 2011; Last Update: November 3, 2011.
  - N-Acetyl-N-(2-[¹⁸F]fluoroethoxybenzyl)-2-phenoxy-5-pyridinamine [PDF Version]
    [¹⁸F]FEPPA
    Kam Leung.
    Created: August 12, 2008; Last Update: August 22, 2008.
  - N-Benzyl-N-ethyl-2-[7,8-dihydro-7-(2-[¹⁸F]fluoroethyl)-8-oxo-2-phenyl-9H-purin-9-yl]acetamide [PDF Version]
    [¹⁸F]FEAC
    Kam Leung.
    Created: May 6, 2010; Last Update: August 19, 2010.
  - N-Benzyl-N-methyl-2-[7,8-dihydro-7-(2-[¹⁸F]fluoroethyl)-8-oxo-2-phenyl-9H-purin-9-yl]acetamide [PDF Version]
    [¹⁸F]FEDAC
    Kam Leung.
    Created: May 6, 2010; Last Update: August 19, 2010.
  - O-(2-[¹⁸F]Fluoroethyl)-L-tyrosine [PDF Version]
    [¹⁸F]FET
    Kam Leung.
    Created: September 15, 2005; Last Update: December 6, 2011.
  - O-(3-[¹⁸F]Fluoropropyl)-L-tyrosine [PDF Version]
    [¹⁸F]FPT
    Kam Leung.
    Created: February 18, 2005; Last Update: December 5, 2011.
  - p-(2-[¹⁸F]Fluoroethyl)-l-phenylalanine [PDF Version]
    [¹⁸F]FEP
    Kam Leung.
    Created: February 7, 2011; Last Update: June 16, 2011.
  - P²,P³-[¹⁸F]Monofluoromethylene diadenosine-5’,5’’’-P¹,P⁴-tetraphosphate [PDF Version]
    [¹⁸F]AppCHFppA
    Huiming Zhang.
    Created: March 20, 2008; Last Update: April 21, 2008.
  - Para-[¹⁸F]-fluorohippurate [PDF Version]
    [¹⁸F]-PFH
    Hariprasad Gali and Arvind Chopra.
    Created: January 4, 2011; Last Update: February 24, 2011.
  - PEGylated 4-[¹⁸F]fluorobenzoyl-NAVPNLRGDLQVLAQKVART [PDF Version]
    PEGylated [¹⁸F]FBA-A20FMDV2
    Arvind Chopra.
    Created: July 17, 2009; Last Update: October 1, 2009.
  - Polyethylene glycol-Cys-Arg-Ser-Gly-Pro-Leu-Gly-Val-Tyr-[¹⁸F]fluorobenzoyl-Lys-Lys-tetramethylrhodamine [PDF Version]
    PEG-peptide-[¹⁸F]-TMR
    Kam Leung.
    Created: February 6, 2012; Last Update: May 10, 2012.
  - syn-1-Amino-3-[¹⁸F]fluorocyclobutane-1-carboxylic acid [PDF Version]
    syn-3-[¹⁸F]FACBC
    Kam Leung.
    Created: November 18, 2010; Last Update: February 10, 2011.
  - Trans-1,2,3,5,6,10b-hexahydro-6-[4-([¹⁸F]fluoroethylthio)-phenyl]pyrrolo-[2,1-a]-isoquinoline [PDF Version]
    [¹⁸F]FEMcN
    Arvind Chopra.
    Created: May 29, 2007; Last Update: June 27, 2007.
  - Trans-4-(N-Methylamino)-4´-{2-[2-(2-[¹⁸F]fluoro-ethoxy)-ethoxy]-ethoxy}-stilbene [PDF Version]
    [¹⁸F]BAY94-9172
    Kam Leung.
    Created: May 11, 2009; Last Update: June 5, 2009.
- 44Sc
  - ⁴⁴Sc-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid–conjugated puromycin [PDF Version]
    [⁴⁴Sc]-DOTA-Pur
    Arvind Chopra.
    Created: January 28, 2013; Last Update: February 28, 2013.
- 60,61,62,64, 67Cu
  - Copper(II) diacetyl-di(N⁴-methylthiosemicarbazone) [PDF Version]
    Cu-ATSM
    The MICAD Research Team.
    Created: November 10, 2004; Last Update: July 31, 2005.
  - Copper pyruvaldehyde bis(N⁴-methylthiosemicarbazone) complex [PDF Version]
    Cu-PTSM
    The MICAD Research Team.
    Created: December 3, 2004; Last Update: January 3, 2005.
- 64Cu
  - [⁶⁴Cu](1-N-(4-aminobenzyl)-3,6,10,13,16,19-hexaazabicyclo[6.6.6]-eicosane-1,8-diamine)-anti-GD2 monoclonal antibody [PDF Version]
    Arvind Chopra.
  - [⁶⁴Cu]-1,4,7,10-Tetra-azacyclododecane-N,N’,N’’,N’’’-tetraacetic acid conjugated knottin 2.5D [PDF Version]
    [⁶⁴Cu] Knottin 2.5D
    Arvind Chopra.
    Created: March 23, 2009; Last Update: May 28, 2009.
  - [⁶⁴Cu]-1,4,7,10-Tetra-azacyclododecane-N,N’,N’’,N’’’-tetraacetic acid conjugated knottin 2.5F [PDF Version]
    [⁶⁴Cu] Knottin 2.5F
    Arvind Chopra.
    Created: March 25, 2009; Last Update: May 28, 2009.
  - ⁶⁴Cu-[Ac-NIe-Asp-His-d-Phe-Arg-Trp-Gly-Lys(1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid)-NH₂] [PDF Version]
    ⁶⁴Cu-DOTA-NAPamide
    Kenneth T. Cheng, Sam Gambhir, and Zhen Cheng.
    Created: August 10, 2007; Last Update: December 3, 2007.
  - ⁶⁴Cu-[cinnamoyl-Phe-D-Leu-Phe-D-Leu-Phe-Lys(PEG-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid)-NH₂] [PDF Version]
    cFLFLFK-PEG-⁶⁴Cu
    Arvind Chopra and Dongfeng Pan.
    Created: November 1, 2007; Last Update: May 30, 2008.
  - ⁶⁴Cu-{N-[1,4,8,11-Tetraazacyclotetradecanyl-1,4-phenylenebis(methylene)]-2-(aminomethyl)pyridine} [PDF Version]
    ⁶⁴Cu-AMD3465
    Kam Leung.
    Created: September 15, 2011; Last Update: January 5, 2012.
  - ⁶⁴Cu-1,4,7,10-4,11-Bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-rhenium-cyclized-[Cys^3,4,10,D-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ⁶⁴Cu-CBTE2A-ReCCMSH(Arg¹¹)
    Kam Leung.
    Created: December 30, 2008; Last Update: May 11, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclodecane-N,N',N'',N'''-tetraacetic acid-vascular endothelial growth factor [PDF Version]
    ⁶⁴Cu-DOTA-VEGF
    Kenneth T. Cheng.
    Created: December 19, 2006; Last Update: January 28, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-anti-CD105 TRC105 chimeric monoclonal antibody [PDF Version]
    ⁶⁴Cu-DOTA-TRC105
    Kam Leung.
    Created: October 27, 2011; Last Update: January 12, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Arg-Arg-Natl-Cys-Tyr-Cit-Lys-d-Lys-Pro-Tyr-Arg-Cit-Cys-Arg-NH₂ [PDF Version]
    ⁶⁴Cu-DOTA-NFB
    Kam Leung.
    Created: November 15, 2011; Last Update: February 9, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Arg-rich Cys knot scaffold grafted with integrin α_vβ₆-binding peptide RSLARTDLDHLRGR [PDF Version]
    ⁶⁴Cu-DOTA-R₀1
    Kam Leung.
    Created: August 16, 2012; Last Update: November 29, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Arg-rich Cys knot scaffold grafted with integrin α_vβ₆-binding peptide RSLARTDLDHLRGR [PDF Version]
    ⁶⁴Cu-DOTA-R₀2
    Kam Leung.
    Created: August 16, 2012; Last Update: November 22, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Asp-Gly-Glu-Ala [PDF Version]
    ⁶⁴Cu-DOTA-DGEA
    Kam Leung.
    Created: January 3, 2012; Last Update: March 15, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-cyclo(CGNSNPKSC) [PDF Version]
    ⁶⁴Cu-DOTA-GX1
    Kam Leung.
    Created: January 30, 2012; Last Update: May 3, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-epidermal growth factor receptor-binding fibronectin domain E13.4.3' [PDF Version]
    ⁶⁴Cu-DOTA-Fn_E13.4.3'
    Kam Leung.
    Created: May 3, 2012; Last Update: August 9, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Ser-rich Cys knot scaffold grafted with integrin α_vβ₆-binding peptide RSLARTDLDHLRGR [PDF Version]
    ⁶⁴Cu-DOTA-S₀2
    Kam Leung.
    Created: August 16, 2012; Last Update: November 22, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-triacetic acid-(Gly-Ser-Gly)-Lys-Cys-Cys-Tyr-Ser-Leu [PDF Version]
    ⁶⁴Cu-DO3A-(GSG)-KCCYSL
    Kam Leung.
    Created: April 26, 2012; Last Update: July 5, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-triacetic acid-human serum albumin-Ac-Cys-Z_EGFR:1907 [PDF Version]
    ⁶⁴Cu-DO3A-HSA-Z_EGFR:1907
    Kam Leung.
    Created: June 25, 2012; Last Update: September 27, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-tris-acetic acid-10-maleimidethylacetamide-Ac-Cys-Z_EGFR:1907 [PDF Version]
    ⁶⁴Cu-DOTA-Z_EGFR:1907
    Kam Leung.
    Created: June 21, 2012; Last Update: September 27, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-Tris-acetic acid-10-maleimidoethylacetamide-ACEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTG [PDF Version]
    ⁶⁴Cu-DOTA-pHLIP
    Liang Shan.
    Created: May 29, 2009; Last Update: July 27, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-β max tris(acetic acid)-10-acetate mono(N-ethylmaleimide amide)-dimeric (Z_HER2:477)₂ [PDF Version]
    ⁶⁴Cu-DOTA-(Z_HER2:477)₂
    Liang Shan.
    Created: November 2, 2011; Last Update: November 30, 2011.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-β max tris(acetic acid)-10-acetate mono(N-ethylmaleimide amide)-monomeric Z_HER2:477 [PDF Version]
    ⁶⁴Cu-DOTA-Z_HER2:477
    Liang Shan.
    Created: November 2, 2011; Last Update: November 30, 2011.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-anti-prostate-specific membrane antigen 3/A12 monoclonal antibody [PDF Version]
    ⁶⁴Cu-DOTA-3/A12
    Kam Leung.
    Created: August 1, 2009; Last Update: September 16, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Asp-cyclohexylalanine-Phe-D-Ser-D-Arg-Tyr-Leu-Trp-Ser [PDF Version]
    ⁶⁴Cu-DOTA-AE105
    Kam Leung.
    Created: January 7, 2009; Last Update: March 3, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Asp-cyclohexylalanine-Phe-d-Ser-d-Arg-Tyr-Leu-Trp-Ser-NH₂ (AE105-NH₂) [PDF Version]
    ⁶⁴Cu-DOTA-AE105-NH₂
    Kam Leung.
    Created: May 18, 2012; Last Update: August 23, 2012.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-cetuximab [PDF Version]
    ⁶⁴Cu-DOTA-cetuximab
    Kam Leung.
    Created: February 6, 2007; Last Update: June 15, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-C-type atrial natriuretic factor [PDF Version]
    ⁶⁴Cu-DOTA-C-ANF
    Liang Shan.
    Created: July 14, 2010; Last Update: August 24, 2010.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid- cyclic arginine-glycine-aspartic acid peptide [PDF Version]
    ⁶⁴Cu-DOTA-c(RGDyK)
    Kenneth T. Cheng.
    Created: February 7, 2007; Last Update: May 20, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-E(E{E[c(RGDyK)]₂}₂)₂ peptide [PDF Version]
    ⁶⁴Cu-DOTA-RGD Octamer
    Kenneth T. Cheng.
    Created: August 16, 2007; Last Update: February 21, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-E{E[c(RGDfK)]₂}₂ [PDF Version]
    ⁶⁴Cu-DOTA-E{E[c(RGDfK)]₂}₂
    Kenneth T. Cheng.
    Created: February 27, 2007; Last Update: February 21, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-E{E[c(RGDyK)]₂}₂ [PDF Version]
    ⁶⁴Cu-DOTA-E{E[c(RGDyK)]₂}₂
    The MICAD Research Team.
    Created: August 10, 2007; Last Update: August 29, 2007.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-HB22.7 [PDF Version]
    ⁶⁴Cu-DOTA-HB22.7
    Kam Leung.
    Created: February 20, 2009; Last Update: May 15, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-interleukin-18-binding protein-Fc [PDF Version]
    ⁶⁴Cu-DOTA-IL-18bp-Fc
    Kam Leung.
    Created: February 23, 2009; Last Update: May 15, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-panitumumab [PDF Version]
    ⁶⁴Cu-DOTA-Panitumumab
    Kam Leung.
    Created: June 25, 2010; Last Update: September 30, 2010.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-p-benzyl-NH-hu14.18K322A [PDF Version]
    ⁶⁴Cu-DOTA-Bn-NH-hu14.18K322A
    Kam Leung.
    Created: December 16, 2012; Last Update: March 14, 2013.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-PEGylated cyclic arginine-glycine-aspartic acid peptide [PDF Version]
    ⁶⁴Cu-DOTA-PEG-c(RGDyK)
    The MICAD Research Team.
    Created: May 10, 2007; Last Update: July 17, 2007.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-PEGylated dimeric cyclic arginine-glycine-aspartic acid peptide [PDF Version]
    ⁶⁴Cu-DOTA-PEG-E[c(RGDyK)]₂
    Kenneth T. Cheng.
    Created: June 1, 2007; Last Update: May 8, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-polyethylene glycol 12 anti–tumor-associated glycoprotein 72 diabody [PDF Version]
    ⁶⁴Cu-PEG12 AVP04-07
    Liang Shan.
    Created: June 23, 2010; Last Update: September 1, 2010.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-polyethylene glycol 27 anti–tumor-associated glycoprotein 72 diabody [PDF Version]
    ⁶⁴Cu-PEG27 AVP04-07
    Liang Shan.
    Created: June 23, 2010; Last Update: July 19, 2010.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-polyethylene glycol-single-chain Cys-tagged vascular endothelial growth factor-121 [PDF Version]
    ⁶⁴Cu-DOTA-PEG-scVEGF
    Kam Leung.
    Created: February 27, 2008; Last Update: March 22, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-polyethylene-glycol-single-walled nanotube-c(RGDyK) [PDF Version]
    ⁶⁴Cu-DOTA-SWNT-PEG-c(RGDyK)
    Kam Leung.
    Created: October 6, 2008; Last Update: October 21, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-T84.66 scFv-human serum albumin [PDF Version]
    ⁶⁴Cu-DOTA-T84.66 scFv-HSA
    Kam Leung.
    Created: July 2, 2008; Last Update: September 2, 2008.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-vascular endothelial growth factor-121(D63AE64AE67A) [PDF Version]
    ⁶⁴Cu-DOTA-VEGF_DEE
    Kam Leung.
    Created: September 17, 2007; Last Update: October 22, 2007.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-1,4,7,10-tetraacetic acid-rhenium-cyclized-[Cys^3,4,10,D-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ⁶⁴Cu-DOTA-ReCCMSH(Arg¹¹)
    Kam Leung.
    Created: December 30, 2008; Last Update: May 11, 2009.
  - ⁶⁴Cu-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid agouti-related protein-7C [PDF Version]
    ⁶⁴Cu-DOTA-AgRP-7C
    Kam Leung.
    Created: May 23, 2010; Last Update: July 16, 2010.
  - ⁶⁴Cu-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-cyclo(Arg-Gly-Asp-d-Phe-Lys) [PDF Version]
    ⁶⁴Cu-NODAGA-c(RGDfK)
    Kam Leung.
    Created: November 28, 2011; Last Update: February 16, 2012.
  - ⁶⁴Cu-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-cyclo(Arg-Gly-Asp-d-Tyr-Lys) [PDF Version]
    ⁶⁴Cu-NODAGA-c(RGDyK)
    Kam Leung.
    Created: March 28, 2013; Last Update: June 6, 2013.
  - ⁶⁴Cu-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-p-Cl-Phe-cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH₂ [PDF Version]
    ⁶⁴Cu-NODAGA-LM3
    Kam Leung.
    Created: May 5, 2012; Last Update: August 16, 2012.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4,7-triacetic acid-Arg-Arg-Natl-Cys-Tyr-Cit-Lys-d-Lys-Pro-Tyr-Arg-Cit-Cys-Arg-NH₂ [PDF Version]
    ⁶⁴Cu-NOTA-NFB
    Kam Leung.
    Created: November 15, 2011; Last Update: February 9, 2012.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4,7-triacetic acid-p-isothiocyanatobenzyl-ALT-836 [PDF Version]
    ⁶⁴Cu-NOTA-ALT-836
    Kam Leung.
    Created: December 6, 2012; Last Update: March 21, 2013.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-7-triacetic acid-8-aminooctanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ⁶⁴Cu-NOTA-8-Aoc-BBN[7-14]NH₂
    Kam Leung.
    Created: June 26, 2009; Last Update: July 24, 2009.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-c(RGDyK)-bombesin[7-14] [PDF Version]
    ⁶⁴Cu-NOTA-RGD-BBN
    Kam Leung.
    Created: October 26, 2009; Last Update: January 28, 2010.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-diacetate-8-aminooctanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ⁶⁴Cu-NO2A-8-Aoc-BBN[7-14]NH₂
    Kam Leung.
    Created: June 26, 2009; Last Update: July 23, 2009.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-diacetic acid-(Gly-Ser-Gly)-Lys-Cys-Cys-Tyr-Ser-Leu [PDF Version]
    ⁶⁴Cu-NO2A-(GSG)-KCCYSL
    Kam Leung.
    Created: April 26, 2012; Last Update: July 5, 2012.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-diacetic acid-6-aminohexanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ⁶⁴Cu-NO2A-(6-Ahx)-BBN(7–14)NH₂
    Liang Shan.
    Created: January 2, 2011; Last Update: January 25, 2011.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-diacetic acid-9-aminonanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ⁶⁴Cu-NO2A-(9-Anc)-BBN(7–14)NH₂
    Liang Shan.
    Created: January 2, 2011; Last Update: January 25, 2011.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-diacetic acid-c(RGDyK)-Glu-6-aminohexanoic acid-bombesin[7-14]NH₂ [PDF Version]
    ⁶⁴Cu-NO2A-RGD-Glu-6-Ahx-BBN
    Kam Leung.
    Created: August 6, 2012; Last Update: November 8, 2012.
  - ⁶⁴Cu-1,4,7-Triazacyclononane-1,4-diacetic acid-para-aminobenzoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ⁶⁴Cu-NO2A-(AMBA)-BBN(7–14)NH₂
    Liang Shan.
    Created: January 2, 2011; Last Update: January 25, 2011.
  - ⁶⁴Cu-1,4,8,11-Tetraazacyclotetradecane-N,N',N",N"'-tetraacetic acid-D-Phe-cyclo(Cys-Tyr-D-Trp-Lys-Thr-Cys)-Thr(OH) [PDF Version]
    ⁶⁴Cu-TETA-Y3-TATE
    Kam Leung.
    Created: September 1, 2009; Last Update: October 8, 2009.
  - ⁶⁴Cu-1,4,8,11-Tetraazacyclotetradecane-regioselectively addressable functionalized template-[cyclo-(Arg-Gly-Asp-d-Phe-Lys)]₄ [PDF Version]
    ⁶⁴Cu-Cyclam-RAFT-c(-RGDfK-)₄
    Kam Leung.
    Created: August 9, 2011; Last Update: December 1, 2011.
  - ⁶⁴Cu-4,11-Bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-cyclic-arginine-glycine-aspartic acid peptide [PDF Version]
    ⁶⁴Cu-CB-TE2A-c(RGDyK)
    Kenneth T. Cheng.
    Created: May 9, 2007; Last Update: May 20, 2008.
  - ⁶⁴Cu-4,11-Bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-D-Phe-cyclo(Cys-Tyr-D-Trp-Lys-Thr-Cys)-Thr(OH) [PDF Version]
    ⁶⁴Cu-CB-TE2A-Y3-TATE
    Kam Leung.
    Created: September 1, 2009; Last Update: October 8, 2009.
  - ⁶⁴Cu-4,11-bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-LLP2A [PDF Version]
    ⁶⁴Cu-CB-TE2A-LLP2A
    Kam Leung.
    Created: June 10, 2009; Last Update: August 12, 2009.
  - ⁶⁴Cu-4,11-Bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-p-Cl-Phe-cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH₂ [PDF Version]
    ⁶⁴Cu-CB-TE2A-LM3
    Kam Leung.
    Created: May 5, 2012; Last Update: August 16, 2012.
  - ⁶⁴Cu-4,11-Bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-Phe(4-NO₂)-cyclo(D-Cys-Tyr-D-Trp-Lys-Thr-Cys)-D-Tyr-NH₂ [PDF Version]
    ⁶⁴Cu-CB-TE2A-sst₂-ANT
    Kam Leung.
    Created: September 1, 2009; Last Update: October 15, 2009.
  - ⁶⁴Cu-Anti-human integrin α_vβ₃ monoclonal antibody [PDF Version]
    ⁶⁴Cu-DOTA-hLM609-II
    Kenneth T. Cheng.
    Created: January 31, 2007; Last Update: February 13, 2008.
  - ⁶⁴Cu-Bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-(Gly-Ser-Gly)-Lys-Cys-Cys-Tyr-Ser-Leu [PDF Version]
    ⁶⁴Cu-CB-TE2A-(GSG)-KCCYSL
    Kam Leung.
    Created: April 26, 2012; Last Update: July 5, 2012.
  - ⁶⁴Cu-Bis(carboxymethyl)-1,4,8,11-tetraazabicyclo[6.6.2]hexadecane-cyclo(Arg-Gly-Asp-d-Phe-Lys) [PDF Version]
    ⁶⁴Cu-CB-TE2A-c(RGDfK)
    Kam Leung.
    Created: November 28, 2011; Last Update: February 16, 2012.
  - ⁶⁴Cu-Diethylenetriamine pentaacetic acid-NH-CO-CH₂-S-CH₂-Phe-Pro-Arg-CH₂-prothrombin [PDF Version]
    ⁶⁴Cu-DTPA-ProT
    Liang Shan.
    Created: March 15, 2012; Last Update: May 15, 2012.
  - ⁶⁴Cu-DOTA-[Pro¹,Tyr⁴]-Bombesin[1-14] [PDF Version]
    ⁶⁴Cu-MP2346
    Kenneth T. Cheng, Jason S. Lewis, and Gráinne B. Biddlecombe.
    Created: August 16, 2007; Last Update: January 8, 2008.
  - ⁶⁴Cu-DOTA hu4D5v8 (scFv-C_H2-C_H3)₂ [PDF Version]
    ⁶⁴Cu-DOTA hu4D5v8 scFv-Fc DM
    Kenneth T. Cheng.
    Created: April 11, 2006; Last Update: April 3, 2008.
  - ⁶⁴Cu-Labeled, 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-chelated, and cysteine-modified anti-activated leukocyte cell adhesion molecule diabody [PDF Version]
    ⁶⁴Cu-DOTA-CysDb
    Liang Shan.
    Created: November 7, 2012; Last Update: November 28, 2012.
  - ⁶⁴Cu-Labeled 1,1’-{1,4-phenylenebis(methylene)}-bis{1,4,8,11-tetraaza-cyclotetradecane} [PDF Version]
    [⁶⁴Cu]-AMD3100
    Arvind Chopra.
    Created: June 8, 2009; Last Update: July 7, 2009.
  - ⁶⁴Cu-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH₂ with a disulfide bridge between the two homoC [PDF Version]
    ⁶⁴Cu-DOTA-MUT-DS
    Liang Shan.
    Created: November 15, 2011; Last Update: December 21, 2011.
  - ⁶⁴Cu-Labeled 1,4,7,10-Tetraazacyclododedane-N,N’,N’’,N’’’-tetraacetic acid–conjugated vascular endothelial growth factor A isoform 121-gelonin fusion protein [PDF Version]
    ⁶⁴Cu-DOTA-VEGF₁₂₁/rGel
    Liang Shan.
    Created: July 6, 2011; Last Update: August 10, 2011.
  - ⁶⁴Cu-Labeled 1,4,7-tris(acetic acid)-10-vinylsulfone-1,4,7,10-tetraazacyclododecane conjugated to Cys⁴⁰-Exendin-4 [PDF Version]
    ⁶⁴Cu-DO3A-VS-Cys⁴⁰-Exendin-4
    Arvind Chopra.
    Created: August 24, 2011; Last Update: March 15, 2012.
  - ⁶⁴Cu-Labeled 4-((8-amino-3,6,10,13,16,19-hexaazabicyclo [6.6.6] icosane-1-ylamino)methyl)benzoic acid (AmBaSar) [PDF Version]
    [⁶⁴Cu]-AmBaSar
    Arvind Chopra.
    Created: September 23, 2010; Last Update: October 28, 2010.
  - ⁶⁴Cu-Labeled 4-((8-amino-3,6,10,13,16,19-hexaazabicyclo [6.6.6] icosane-1-ylamino)methyl)benzoic acid (AmBaSar) conjugated to cyclic arginine-glycine-aspartic acid (RGD) peptide [PDF Version]
    [⁶⁴Cu]-AmBaSar-RGD
    Arvind Chopra.
    Created: September 20, 2010; Last Update: October 28, 2010.
  - ⁶⁴Cu-Labeled anti-c-kit monoclonal antibody 12A8 Fab fragment [PDF Version]
    [⁶⁴Cu]12A8 Fab
    Arvind Chopra.
    Created: June 9, 2011; Last Update: June 30, 2011.
  - ⁶⁴Cu-Labeled bis-1,4,7,10-tetraazacyclododecane-N,N',N,N'-tetraacetic acid conjugated hypericin [PDF Version]
    [⁶⁴Cu]-bis DOTA-hypericin
    Arvind Chopra.
    Created: May 3, 2011; Last Update: May 26, 2011.
  - ⁶⁴Cu-Labeled cysteine–tagged dimeric epidermal growth factor [PDF Version]
    [⁶⁴Cu]Cys-dEGF
    Arvind Chopra.
    Created: May 18, 2009; Last Update: July 15, 2009.
  - ⁶⁴Cu-Labeled cysteine–tagged epidermal growth factor [PDF Version]
    [⁶⁴Cu]Cys-EGF
    Arvind Chopra.
    Created: May 18, 2009; Last Update: July 15, 2009.
  - ⁶⁴Cu-Labeled DOTA conjugated anti-epithelial membrane protein 2 minibody KS83 [PDF Version]
    [⁶⁴Cu]-DOTA-KS83
    Arvind Chopra.
    Created: February 20, 2013; Last Update: February 28, 2013.
  - ⁶⁴Cu-Labeled DOTA-conjugated rituximab, a chimeric murine/human anti-CD20 monoclonal antibody [PDF Version]
    [⁶⁴Cu]-DOTA-Rituximab
    Arvind Chopra.
    Created: September 20, 2012; Last Update: October 25, 2012.
  - ⁶⁴Cu-Labeled human serum albumin–conjugated Affibody Z_HER2:342 that targets the human epidermal growth factor receptor 2 (HER2) [PDF Version]
    [⁶⁴Cu]-DOTA-HSA-Z_HER2:342
    Arvind Chopra.
    Created: May 19, 2011; Last Update: June 1, 2011.
  - ⁶⁴Cu-Labeled l-histidine [PDF Version]
    [⁶⁴Cu]-His
    Arvind Chopra.
    Created: June 14, 2012; Last Update: July 26, 2012.
  - ⁶⁴Cu-Labeled Lys⁴⁰(1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid)NH₂–conjugated exendin-4 [PDF Version]
    [⁶⁴Cu](Lys⁴⁰(DOTA)NH₂)Exendin-4
    Arvind Chopra.
    Created: January 25, 2012; Last Update: February 23, 2012.
  - ⁶⁴Cu-Labeled Oxo-DO3A-conjugated trastuzumab and PCTA-conjugated trastuzumab [PDF Version]
    [⁶⁴Cu]-Oxo-DO3A-trastuzumab and [⁶⁴Cu]-PCTA-trastuzumab
    Arvind Chopra.
    Created: July 24, 2012; Last Update: August 23, 2012.
  - ⁶⁴Cu-Labeled PEGylated nano-graphene oxide (GO) covalently linked to NOTA-conjugated anti-CD105 (endoglin) chimeric monoclonal antibody TRC105 [PDF Version]
    [⁶⁴Cu]-NOTA-GO-TRC105
    Arvind Chopra.
    Created: May 17, 2012; Last Update: June 28, 2012.
  - ⁶⁴Cu-N,N'-Bis(S-benzoyl-thioglycoloyl)diaminopropanoate-KRAS-PNA-d(Cys-Ser-Lys-Cys) [PDF Version]
    ⁶⁴Cu-WT4351
    Kenneth T. Cheng, Atis Chakrabart, Mohan R. Aruva, Mathew L. Thakur, and Eric Wickstrom.
    Created: August 10, 2007; Last Update: January 3, 2008.
  - ⁶⁴Cu-Polyethylenimine [PDF Version]
    ⁶⁴Cu-PEI
    Kam Leung.
    Created: April 16, 2010; Last Update: July 1, 2010.
  - ⁶⁴Cu-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-conatumumab [PDF Version]
    ⁶⁴Cu-DOTA-conatumumab
    Kam Leung.
    Created: October 8, 2011; Last Update: December 29, 2011.
  - ⁶⁴Cu-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-MEDI-522 [PDF Version]
    ⁶⁴Cu-DOTA-MEDI-522
    Kam Leung.
    Created: June 8, 2011; Last Update: June 30, 2011.
  - ⁶⁴Cu-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-TNYLFSPNGPIARAW (TNYL-RAW) [PDF Version]
    ⁶⁴Cu-DOTA-TNYL-RAW
    Kam Leung.
    Created: September 10, 2011; Last Update: December 15, 2011.
  - ⁶⁴Cu-Z-E-(1,8-Diamino-3,6,10,13,16,19-hexaazabicyclo(6,6,6)eicosane)-aminohexanoyl-Asp-Gly-Glu-Ala [PDF Version]
    ⁶⁴Cu-Z-E(diamsar)-Ahx-DGEA
    Kam Leung.
    Created: January 3, 2012; Last Update: March 15, 2012.
  - Copper 1,4,8,11-tetraazacyclotetradecane-N,N',N'',N'''-tetraacetic acid-octreotide [PDF Version]
    Cu-TETA-OC
    The MICAD Research Team.
    Created: December 20, 2004; Last Update: March 14, 2005.
  - HSDAVFTDNYTKLRKQ-NIe-AVKK-(3-OCH3,4-OH)-FLNSSV-GABA-L-(Dap-(BMA)₂)-⁶⁴Cu [PDF Version]
    ⁶⁴Cu-TP3939
    Kenneth T. Cheng and Mathew L. Thakur.
    Created: March 17, 2008; Last Update: June 11, 2008.
  - NR-LU-10/streptavidin-copper 64-(1,4,7,10-tetraazacyclododecane-N,N′,N′′,N′′′-tetraacetic acid)-biotin [PDF Version]
    NR-LU-10/SA-⁶⁴Cu-DOTA-biotin
    The MICAD Research Team.
    Created: February 15, 2005; Last Update: May 25, 2005.
- 66Ga
  - ⁶⁶Ga-Labeled NOTA-conjugated anti-CD105 (endoglin) chimeric monoclonal antibody [PDF Version]
    [⁶⁶Ga]-NOTA-TRC105
    Arvind Chopra.
    Created: May 10, 2012; Last Update: June 21, 2012.
  - ⁶⁶Ga-Labeled PEGylated nano-graphene oxide (GO) covalently linked to NOTA-conjugated anti-CD105 (endoglin) chimeric monoclonal antibody TRC105 [PDF Version]
    [⁶⁶Ga]-NOTA-GO-TRC105
    Arvind Chopra.
    Created: May 14, 2012; Last Update: June 28, 2012.
- 68Ga
  - ^67/68Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-1,2-diaminoethane-γ-folate [PDF Version]
    ^67/68Ga-P3026
    Kam Leung.
    Created: February 14, 2011; Last Update: May 26, 2011.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Cpa-cyclo(d-Cys-amino-Phe-hydroorotic acid-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)-D-Tyr-NH₂ (JR11) [PDF Version]
    ⁶⁸Ga-DOTA-JR11
    Kam Leung.
    Created: October 7, 2012; Last Update: January 3, 2013.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-p-Cl-Phe-cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH₂ [PDF Version]
    ⁶⁸Ga-DOTA-LM3
    Kam Leung.
    Created: May 5, 2012; Last Update: November 1, 2012.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-aminohexanoic acid-Lys⁴⁰-exendin-4 [PDF Version]
    [Lys⁴⁰(Ahx-DOTA-⁶⁸Ga)NH₂]-exendin-4
    Kam Leung.
    Created: January 30, 2012; Last Update: April 26, 2012.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-cyclo(Arg-Gly-Asp-D-Phe-Lys) [PDF Version]
    ⁶⁸Ga-DOTA-c(RGDfK)
    Kam Leung.
    Created: October 9, 2007; Last Update: December 10, 2009.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Epidermal growth factor [PDF Version]
    ⁶⁸Ga-DOTA-EGF
    Kam Leung.
    Created: July 25, 2006; Last Update: April 10, 2012.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Gly-Gly-Gly-Gly-Lys-Gly-Gly-Gly-Gly [PDF Version]
    ⁶⁸Ga-DOTA-VAP-P1
    Kam Leung.
    Created: March 1, 2008; Last Update: May 15, 2008.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-HER2-specific Affibody Z_HER2:2891 [PDF Version]
    ⁶⁸Ga-DOTA-Z_HER2:2891
    Kam Leung.
    Created: August 26, 2012; Last Update: December 12, 2012.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Lys⁴⁰-exendin-3 [PDF Version]
    ⁶⁸Ga-DOTA-Lys⁴⁰-exendin-3
    Kam Leung.
    Created: August 20, 2010; Last Update: November 3, 2010.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-synthetic HER2 specific Affibody Z_{HER2:342-pep2} [PDF Version]
    ⁶⁸Ga-DOTA-Z_{HER2:342-pep2}
    Kam Leung.
    Created: August 26, 2010; Last Update: November 10, 2010.
  - ⁶⁸Ga-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-1,4,7,10-tetraacetic acid-rhenium-cyclized-[Cys^3,4,10,D-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ⁶⁸Ga-DOTA-ReCCMSH(Arg¹¹)
    Kam Leung.
    Created: January 30, 2009; Last Update: May 11, 2009.
  - ⁶⁸Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-1,2-diaminoethane-γ-5,8-dideazfolic acid (P3238) [PDF Version]
    ⁶⁸Ga-P3238
    Kam Leung.
    Created: June 14, 2012; Last Update: September 20, 2012.
  - ⁶⁸Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-1,2-diaminoethane-γ-folate (P3246) [PDF Version]
    ⁶⁸Ga-P3246
    Kam Leung.
    Created: June 14, 2012; Last Update: September 20, 2012.
  - ⁶⁸Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-Asp-cyclohexylalanine-Phe-d-Ser-d-Arg-Tyr-Leu-Trp-Ser-NH₂ (AE105-NH₂) [PDF Version]
    ⁶⁸Ga-NODAGA-AE105-NH₂
    Kam Leung.
    Created: May 20, 2012; Last Update: August 23, 2012.
  - ⁶⁸Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-Cpa-cyclo(d-Cys-amino-Phe-hydroorotic acid-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)-D-Tyr-NH₂ (JR11) [PDF Version]
    ⁶⁸Ga-NODAGA-JR11
    Kam Leung.
    Created: October 5, 2012; Last Update: January 3, 2013.
  - ⁶⁸Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-cyclo(Arg-Gly-Asp-d-Phe-Lys) [PDF Version]
    ⁶⁸Ga-NODAGA-c(RGDfK)
    Kam Leung.
    Created: August 26, 2011; Last Update: November 10, 2011.
  - ⁶⁸Ga-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-p-Cl-Phe-cyclo(D-Cys-Tyr-D-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH₂ [PDF Version]
    ⁶⁸Ga-NODAGA-LM3
    Kam Leung.
    Created: May 5, 2012; Last Update: November 1, 2012.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-2-nitroimidazole-N-ethylamine [PDF Version]
    ⁶⁸Ga-NOTA-NI
    Kam Leung.
    Created: January 19, 2011; Last Update: March 23, 2011.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-c(RGDfK)-human serum albumin-tissue inhibitor of matrix metalloproteinase 2 fusion protein [PDF Version]
    ⁶⁸Ga-NOTA-RGD-HSA-TIMP2
    Kam Leung.
    Created: February 14, 2012; Last Update: May 24, 2012.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-c(RGDyK)-S-S-CPLHSpT [PDF Version]
    ⁶⁸Ga-NOTA-cRGDyK-CPLHSpT
    Kam Leung.
    Created: August 14, 2012; Last Update: October 25, 2012.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-p-isothiocyanatobenzyl-vascular endothelial growth factor-121 [PDF Version]
    ⁶⁸Ga-NOTA-VEGF₁₂₁
    Kam Leung.
    Created: April 7, 2013; Last Update: June 6, 2013.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4,7-triacetic acid-polyethylene glycol-single-chain Cys-tagged vascular endothelial growth factor-121 [PDF Version]
    ⁶⁸Ga-NOTA-PEG-scVEGF
    Kam Leung.
    Created: November 17, 2010; Last Update: February 17, 2011.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-[15-amino-4,7,10,13-tetraoxapentadecanoic acid-c(Arg-Gly-Asp-D-Phe-Lys)]₂ [PDF Version]
    ⁶⁸Ga-NOTA-P₄-RGD2
    Kam Leung.
    Created: October 26, 2009; Last Update: December 10, 2009.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-[c(Arg-Gly-Asp-D-Tyr-Lys)]₂ [PDF Version]
    ⁶⁸Ga-NOTA-RGD2
    Kam Leung.
    Created: October 26, 2009; Last Update: December 10, 2009.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-[Gly-Gly-Gly-c(Arg-Gly-Asp-D-Phe-Lys)]₂ [PDF Version]
    ⁶⁸Ga-NOTA-G₃-RGD2
    Kam Leung.
    Created: October 26, 2009; Last Update: December 10, 2009.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-Glu-c(RGDyK)-bombesin[7-14] [PDF Version]
    ⁶⁸Ga-NOTA-RGD-BBN
    Kam Leung.
    Created: January 2, 2010; Last Update: January 28, 2010.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4-7-triacetic acid-isothiocyanatobenzyl-c(Arg-Gly-Asp-d-Tyr-Lys) [PDF Version]
    ⁶⁸Ga-NOTA-RGD
    Kam Leung.
    Created: January 26, 2011; Last Update: April 7, 2011.
  - ⁶⁸Ga-1,4,7-Triazacyclononane-1,4-diacetic acid-8-aminooctanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ⁶⁸Ga-NOTA-8-Aoc-BBN[7-14]NH₂
    Kam Leung.
    Created: June 26, 2012; Last Update: October 4, 2012.
  - ⁶⁸Ga-CHX-A”-Rhenium-cyclized-[Cys^3,4,10,D-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ⁶⁸Ga-CHX-A”-ReCCMSH(Arg¹¹)
    Kam Leung.
    Created: August 20, 2009; Last Update: September 8, 2010.
  - ⁶⁸Ga-Desferrioxamine p-isothiocyanatobenzyl-anti-EGFR nanobody 7D12 [PDF Version]
    ⁶⁸Ga-Df-Bz-NCS-7D12
    Kam Leung.
    Created: March 21, 2012; Last Update: June 7, 2012.
  - ⁶⁸Ga-DOTA-4-amino-1-carboxymethyl-piperidine-D-Phe-Gln-Trp-Ala-Val-Gly-His-Sta-Leu-NH₂ [PDF Version]
    ⁶⁸Ga-RM2
    Kam Leung.
    Created: February 5, 2011; Last Update: May 4, 2011.
  - ⁶⁸Ga-Glutamate peptide-3 aminoethyl estradiol [PDF Version]
    ⁶⁸Ga-GAP-EDL
    Arvind Chopra.
    Created: August 23, 2007; Last Update: June 18, 2009.
  - ⁶⁸Ga-Isothiocyanatobenzyl-tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-2-(2-nitroimidazolyl)ethylamine [PDF Version]
    ⁶⁸Ga-SCN-Bz-DOTA-NI
    Kam Leung.
    Created: May 19, 2011; Last Update: September 22, 2011.
  - ⁶⁸Ga-Labeled (1,4,7,10-tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid)-1-NaI3-octreotide [PDF Version]
    [⁶⁸Ga]-DOTA-NOC
    Arvind Chopra.
    Created: May 12, 2009; Last Update: June 5, 2009.
  - ⁶⁸Ga-Labeled (4-{[(bis(phosphonomethyl))carbamoyl]methyl}-7,10-bis(carboxymethyl)-1,4,7,10-tetraazacyclododec-1-yl)acetic acid (BPAMD) [PDF Version]
    [⁶⁸Ga]BPAMD
    Arvind Chopra.
    Created: September 18, 2012; Last Update: November 21, 2012.
  - ⁶⁸Ga-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-Tyr-cyclo(DAB-Arg-cyclo(Cys-Phe-d-Trp-Lys-Thr-Cys)) [PDF Version]
    ⁶⁸Ga-AM3
    Liang Shan.
    Created: December 10, 2010; Last Update: January 18, 2011.
  - ⁶⁸Ga-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH₂ with a disulfide bridge between the two homoC [PDF Version]
    ⁶⁸Ga-DOTA-MUT-DS
    Liang Shan.
    Created: November 15, 2011; Last Update: January 4, 2012.
  - ⁶⁸Ga-Labeled 2-[3-(1-carboxy-5-{7-[5-carboxy-5-(3-phenyl-2-{3-phenyl-2-[2-(4,7,10-tris-carboxymethyl-1,4,7,10-tetraazacyclododec-1-l)acetylamino]propionylamino}propionylamino)pentylcarbamoyl]heptanoylamino}pentyl)ureido]pentanedioic acid [PDF Version]
    [⁶⁸Ga]6
    Arvind Chopra.
    Created: September 27, 2010; Last Update: December 28, 2010.
  - ⁶⁸Ga-Labeled 2-[4,7-di(carboxymethyl)-1,4,7-triazonan-1-yl]-5-[(4-hydroxy-4,4-diphosphonobutyl)amino]-5-oxopentanoic acid (NOTA-bisphosphonate (BP)) [PDF Version]
    [⁶⁸Ga]-NOTA-BP
    Arvind Chopra.
    Created: December 7, 2011; Last Update: December 27, 2011.
  - ⁶⁸Ga-Labeled 2-{3-[5-(7-{1-benzyloxycarbonyl-5-[2-(4,7,10-tris-carboxymethyl-1,4,7,10-tetraazacyclododec-1-l)acetylamino]pentylcarbamoyl}-heptanoylamino)-1-carboxypentyl]ureido}pentanedioic acid [PDF Version]
    [⁶⁸Ga]3
    Arvind Chopra.
    Created: September 28, 2010; Last Update: December 28, 2010.
  - ⁶⁸Ga-Labeled alanine derivatives of 1,4,7,10-tetraazacyclododecane-1,7-diacetic acid and 1,4,7,10-tetraazacyclododecane-1,4,7,-triacetic acid [PDF Version]
    ⁶⁸Ga-21, ⁶⁸Ga-22
    Liang Shan.
    Created: August 29, 2011; Last Update: October 12, 2011.
  - ⁶⁸Ga-Labeled anti-EpCAM diabody against epithelial cell adhesion molecule [PDF Version]
    ⁶⁸Ga-HBED-CC-anti-EpCAM diabody
    Kam Leung.
    Created: August 6, 2010; Last Update: November 19, 2010.
  - ⁶⁸Ga-Labeled DOTA-conjugated sCCK8[Phe²(p-CH₂SO₃H),Nle^3,6], a sulfated cholecystokinin 8 (sCCK8) peptide derivative [PDF Version]
    [⁶⁸Ga]sCCK8[Phe²(p-CH₂SO₃H),Nle^3,6
    Arvind Chopra.
    Created: January 10, 2013; Last Update: January 31, 2013.
  - ⁶⁸Ga-Labeled homoalanine derivatives of 1,4,7,10-tetraazacyclododecane-1,7-diacetic acid and 1,4,7,10-tetraazacyclododecane-1,4,7,-triacetic acid [PDF Version]
    ⁶⁸Ga-23, ⁶⁸Ga-24
    Liang Shan.
    Created: August 29, 2011; Last Update: October 12, 2011.
  - ⁶⁸Ga-Labeled NODAGA-conjugated ghrelin receptor agonists and inverse agonists [PDF Version]
    [⁶⁸Ga]-NODAGA-ghrelin derivatives
    Arvind Chopra.
    Created: June 10, 2012; Last Update: July 12, 2012.
  - ⁶⁸Ga-Labeled β-aminoalanine, γ-aminohomoalanine, and ε-aminolysine conjugates of 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid [PDF Version]
    ⁶⁸Ga-2a-c
    Liang Shan.
    Created: August 29, 2011; Last Update: October 12, 2011.
  - ⁶⁸Ga-Labeled β-aminoalanine, γ-aminohomoalanine, and ε-aminolysine conjugates of 1,4,7-triazacyclononane-1,4,7-triacetic acid [PDF Version]
    ⁶⁸Ga-1a-c
    Liang Shan.
    Created: August 29, 2011; Last Update: October 12, 2011.
  - ⁶⁸Ga-N,N’-bis[2-Hydroxy-5-(carboxyethyl)benzyl]ethylenediamine-N,N’-diacetic acid-polyethylene glycol-single-chain Cys-tagged vascular endothelial growth factor-121 [PDF Version]
    ⁶⁸Ga-HBED-CC-PEG-scVEGF
    Kam Leung.
    Created: December 18, 2010; Last Update: February 17, 2011.
  - ⁶⁸Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-2-(2-nitroimidazolyl)ethylamine [PDF Version]
    ⁶⁸Ga-DOTA-NI
    Kam Leung.
    Created: May 19, 2011; Last Update: July 28, 2011.
  - ⁶⁸Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-[cyclo(Arg-Gly-Asp-D-Phe-Lys)]₂ [PDF Version]
    ⁶⁸Ga-DOTA-E-[c(RGDfK)]₂
    Kam Leung.
    Created: February 20, 2011; Last Update: May 12, 2011.
  - ⁶⁸Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-{Glu-[cyclo(Arg-Gly-Asp-d-Phe-Lys)]₂}₂ [PDF Version]
    ⁶⁸Ga-DOTA-E-{E-[c(RGDfK)]₂}₂
    Kam Leung.
    Created: February 19, 2011; Last Update: May 12, 2011.
  - ⁶⁸Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-cyclo(Arg-Gly-Asp-D-Phe-Lys) [PDF Version]
    ⁶⁸Ga-DOTA-E-c(RGDfK)
    Kam Leung.
    Created: February 6, 2011; Last Update: May 12, 2011.
  - ⁶⁸Ga-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-d-Glu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH₂ [PDF Version]
    ⁶⁸Ga-DOTA-MG0
    Kam Leung.
    Created: August 15, 2011; Last Update: November 10, 2011.
  - ⁶⁸Ga-Trastuzumab F(ab’) fragment [PDF Version]
    ⁶⁸Ga-DCHF
    The MICAD Research Team.
    Created: May 18, 2007; Last Update: June 25, 2007.
  - Gallium-68-dotamaleimide-Cys165-annexin A5 [PDF Version]
    ⁶⁸Ga-Cys165-AnxA5
    Liang Shan.
    Created: June 28, 2011; Last Update: August 10, 2011.
  - Gallium-68-dotamaleimide-Cys2-annexin A5 [PDF Version]
    ⁶⁸Ga-Cys2-AnxA5
    Liang Shan.
    Created: June 28, 2011; Last Update: August 10, 2011.
  - Gly-Ala-Cys-Leu-Arg-Ser-Gly-Arg-Gly-Cys-Gly-(PEG)₃-DOTA-⁶⁸Ga [PDF Version]
    ⁶⁸Ga-DOTA-TCTP-1
    Kam Leung.
    Created: December 20, 2010; Last Update: April 7, 2011.
- 74As
  - [⁷⁴As]-Labeled monoclonal antibody against anionic phospholipids [PDF Version]
    Arvind Chopra.
    Created: April 14, 2008; Last Update: May 27, 2008.
- 76Br
  - 4-[⁷⁶Br]Bromophenyl-1,4-diazabicyclo(3.2.2) nonane-4-carboxylate [PDF Version]
    [⁷⁶Br]SSR180711
    Kam Leung.
    Created: December 12, 2008; Last Update: February 24, 2009.
  - 5-[⁷⁶Br]-N-(4-(3,4-Dihydro-6,7-dimethoxyisoquinolin-2(1H)-yl)butyl)-2,3-dimethoxybenzamide [PDF Version]
    [⁷⁶Br]RHM-4
    Kam Leung.
    Created: October 5, 2006; Last Update: April 3, 2012.
  - ⁷⁶Br-Human recombinant anti-ED-B fibronectin L19-small immunoprotein [PDF Version]
    ⁷⁶Br-L19-SIP
    The MICAD Research Team.
    Created: August 4, 2007; Last Update: August 27, 2007.
- 86Y
  - ⁸⁶Y-CHX-A''-Diethylenetriamine pentaacetic acid-bevacizumab [PDF Version]
    ⁸⁶Y-CHX-A''-DTPA-bevacizumab
    Kam Leung.
    Created: December 17, 2010; Last Update: March 16, 2011.
  - ⁸⁶Y-CHX-A''-Diethylenetriamine pentaacetic acid-cetuximab [PDF Version]
    ⁸⁶Y-CHX-A''-DTPA-cetuximab
    Kam Leung.
    Created: August 15, 2010; Last Update: November 11, 2010.
  - ⁸⁶Y-CHX-A''-diethylenetriamine pentaacetic acid-panitumumab [PDF Version]
    ⁸⁶Y-CHX-A''-DTPA-Panitumumab
    Kam Leung.
    Created: August 25, 2011; Last Update: December 8, 2011.
  - ⁸⁶Y-CHX-A”-Rhenium-cyclized-[Cys^3,4,10,D-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ⁸⁶Y-CHX-A”-ReCCMSH(Arg¹¹)
    Kam Leung.
    Created: August 20, 2009; Last Update: September 8, 2010.
  - ⁸⁶Y-DOTA-[Pro¹,Tyr⁴]-Bombesin[1-14] [PDF Version]
    ⁸⁶Y-MP2346
    Kenneth T. Cheng, Jason S. Lewis, and Gráinne B. Biddlecombe.
    Created: August 6, 2007; Last Update: January 8, 2008.
  - ⁸⁶Y-DOTA-rhenium-cyclized-[Cys^3,4,10,D-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ⁸⁶Y-DOTA-ReCCMSH(Arg¹¹)
    Kam Leung.
    Created: May 30, 2009; Last Update: July 14, 2009.
- 89Zr
  - ⁸⁹Zr-Desferrioxamine-anti-CD105 TRC105 chimeric monoclonal antibody [PDF Version]
    ⁸⁹Zr-Df-TRC105
    Kam Leung.
    Created: November 1, 2011; Last Update: January 12, 2012.
  - ⁸⁹Zr-Desferrioxamine-anti-epithelial glycoprotein-1 hRS7 humanized monoclonal antibody [PDF Version]
    ⁸⁹Zr-Df-hRS7
    Kam Leung.
    Created: January 15, 2012; Last Update: April 19, 2012.
  - ⁸⁹Zr-Desferrioxamine B-7E11 anti-prostate-specific membrane antigen monoclonal antibody [PDF Version]
    ⁸⁹Zr-DFO-7E11
    Kam Leung.
    Created: November 22, 2011; Last Update: February 23, 2012.
  - ⁸⁹Zr-Desferrioxamine B-J591 anti-prostate-specific membrane antigen monoclonal antibody [PDF Version]
    ⁸⁹Zr-DFO-J591
    Kam Leung.
    Created: September 12, 2010; Last Update: November 18, 2010.
  - ⁸⁹Zr-Desferrioxamine B-Transferrin [PDF Version]
    ⁸⁹Zr-DFO-Transferrin
    Kam Leung.
    Created: April 1, 2013; Last Update: June 6, 2013.
  - ⁸⁹Zr-Desferrioxamine p-isothiocyanatobenzyl-anti-EGFR nanobody 7D12 [PDF Version]
    ⁸⁹Zr-Df-Bz-NCS-7D12
    Kam Leung.
    Created: March 21, 2012; Last Update: June 7, 2012.
  - ⁸⁹Zr-Desferrioxamine p-isothiocyanatobenzyl-anti-hepatocyte growth factor nanobody 1E2 fused to albumin-binding nanobody Alb8 [PDF Version]
    ⁸⁹Zr-Df-Bz-NCS-1E2-Alb8
    Kam Leung.
    Created: May 17, 2012; Last Update: August 27, 2012.
  - ⁸⁹Zr-Desferrioxamine p-isothiocyanatobenzyl-anti-hepatocyte growth factor receptor 1-armed antibody onartuzumab [PDF Version]
    ⁸⁹Zr-Df-Onartuzumab
    Kam Leung.
    Created: December 1, 2012; Last Update: March 14, 2013.
  - ⁸⁹Zr-Labeled fresolimumab (human anti-transforming growth factor-β monoclonal antibody) [PDF Version]
    [⁸⁹Zr]-Fresolimumab
    Arvind Chopra.
    Created: December 13, 2011; Last Update: January 26, 2012.
  - ⁸⁹Zr-Labeled N-succinyldesferrioxamine-ranibizumab [PDF Version]
    [⁸⁹Zr]-Ranibizumab
    Arvind Chopra.
    Created: January 26, 2011; Last Update: February 24, 2011.
  - ⁸⁹Zr-Labeled N-suc-desferrioxamine-conjugated anti-carbonic anhydrase IX chimeric monoclonal antibody cG250-F(ab’)₂ fragments [PDF Version]
    [⁸⁹Zr]-cG250-F(ab')₂
    Arvind Chopra.
    Created: August 2, 2010; Last Update: October 14, 2010.
  - ⁸⁹Zr-Labeled p-isothiocyanatobenzyl-desferrioxamine B (Df-Bz-NCS)–conjugated panitumumab, a fully human monoclonal antibody directed against the extracellular domain III of the epidermal growth factor receptor [PDF Version]
    [⁸⁹Zr]-Panitumumab
    Arvind Chopra.
    Created: May 4, 2012; Last Update: June 21, 2012.
  - ⁸⁹Zr-Labeled trastuzumab, a humanized monoclonal antibody against epidermal growth factor receptor 2 [PDF Version]
    ⁸⁹Zr-Trastuzumab
    Arvind Chopra.
    Created: January 5, 2010; Last Update: March 4, 2010.
  - ⁸⁹Zr-N-Succinyldesferal-anti-CD44v6 chimeric monoclonal antibody U36 [PDF Version]
    ⁸⁹Zr-N-SucDf-cMAb U36
    Kam Leung.
    Created: March 25, 2010; Last Update: April 22, 2010.
  - ⁸⁹Zr-N-Succinyldesferal-chimeric monoclonal antibody G250 [PDF Version]
    ⁸⁹Zr-Df-cG250
    Kam Leung.
    Created: April 22, 2010; Last Update: May 27, 2010.
  - ⁸⁹Zr-N-Succinyldesferal-human anti-insulin-like growth factor 1 receptor monoclonal antibody R1507 [PDF Version]
    ⁸⁹Zr-R1507
    Kam Leung.
    Created: December 20, 2010; Last Update: February 3, 2011.
  - ⁸⁹Zr-N-Succinyldesferrioxamine-bevacizumab [PDF Version]
    ⁸⁹Zr-Bevacizumab
    Kam Leung.
    Created: October 17, 2008; Last Update: December 16, 2008.
  - ⁸⁹Zr-N-Succinyldesferrioxamine-DN30 [PDF Version]
    ⁸⁹Zr-DN30
    Kam Leung.
    Created: November 17, 2007; Last Update: March 12, 2012.
SPECT
- 111In
  - [¹¹¹In]5-[(3aR,6S,6aS)-2-Oxo-1,3,3a,4,6,6a-hexahydrothieno[3,4-d]imidazol-6-yl]pentanoic acid [PDF Version]
    [¹¹¹In]Biotin
    Arvind Chopra.
    Created: May 1, 2008; Last Update: May 28, 2008.
  - [¹¹¹In]-DOTA-Aminohexanoyl-[D-Phe⁶,Leu-NHCH₂CH₂CH₃¹³,desMet¹⁴] BBN[6-14] [PDF Version]
    [¹¹¹In]Bomproamide
    Arvind Chopra.
    Created: May 20, 2010; Last Update: July 8, 2010.
  - [¹¹¹In]-Ethylenedicysteine-murine anti-phosphotyrosine antibody [PDF Version]
    ¹¹¹In-EC-APT
    Arvind Chopra.
    Created: March 12, 2009; Last Update: April 6, 2009.
  - [¹¹¹In]Labeled-(NAc-dD-CHA-F-dS-dR-Y-L-W-S-βAla)₂-K-K(DOTA) [PDF Version]
    [¹¹¹In]Anti-uPA peptide
    Arvind Chopra.
    Created: April 1, 2010; Last Update: May 27, 2010.
  - [¹¹¹In]-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-heat-stable human Escherichia coli enterotoxin [PDF Version]
    [¹¹¹In]DOTA-F¹⁹-ST_h(1-19)
    Arvind Chopra.
    Created: May 16, 2008; Last Update: June 10, 2008.
  - [¹¹¹In]-Labeled chimeric monoclonal antibody cG250 directed against carbonic anhydrase IX [PDF Version]
    [¹¹¹In]-DOTA-cG250
    Arvind Chopra.
    Created: August 6, 2010; Last Update: September 2, 2010.
  - [¹¹¹In]-Labeled divalent Fab fragment of chimeric monoclonal antibody cG250 directed against carbonic anhydrase IX [PDF Version]
    [¹¹¹In]-DOTA-F(ab’)₂-cG250
    Arvind Chopra.
    Created: August 11, 2010; Last Update: September 2, 2010.
  - [¹¹¹In]-Labeled monovalent Fab fragment of chimeric monoclonal antibody cG250 directed against carbonic anhydrase IX [PDF Version]
    [¹¹¹In]-DOTA-Fab-cG250
    Arvind Chopra.
    Created: August 11, 2010; Last Update: September 2, 2010.
  - [¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Pro¹,Tyr⁴]Bombesin [PDF Version]
    [¹¹¹In-DOTA-Pro¹,Tyr⁴]BN
    Kenneth T. Cheng.
    Created: October 23, 2007; Last Update: November 13, 2007.
  - [¹¹¹In-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-10-maleimidoethylacetamide-Cys⁶¹]-Affibody Z_HER2:2395 [PDF Version]
    [¹¹¹In-MMA-NODAGA-Cys⁶¹]-Z_HER2:2395
    Kam Leung.
    Created: May 20, 2012; Last Update: September 13, 2012.
  - [¹¹¹In-Diethylenetriamine pentaacetic acid-ACMpip⁵,Tha⁶,βAla¹¹,Tha¹³,NIe¹⁴]bombesin(5-14) [PDF Version]
    [¹¹¹In-DTPA-ACMpip⁵,Tha⁶,βAla¹¹,Tha¹³,NIe¹⁴]BN(5-14)
    Kenneth T. Cheng.
    Created: December 18, 2007; Last Update: January 14, 2008.
  - [¹¹¹In-Diethylenetriaminepentaacetic acid-Pro¹,Tyr⁴]bombesin [PDF Version]
    [¹¹¹In-DTPA-Pro¹,Tyr⁴]BN
    Kenneth T. Cheng.
    Created: October 10, 2007; Last Update: November 7, 2007.
  - ¹¹¹In/^125/131I-Labeled anti-mucin-1 murine, chimeric or humanized antibody hPAM4 [PDF Version]
    [¹¹¹In/^125/131I]-hPAM4
    Arvind Chopra.
    Created: June 16, 2011; Last Update: July 26, 2011.
  - ¹¹¹In/¹²⁵I/^99mTc-Labeled N-terminus tri-(histidine-glutamate) (HE)₃-tagged and N- or C-terminus hexahistidine (H6)-tagged anti-epidermal growth factor receptor Affibody Z_HER2:342-C [PDF Version]
    [¹¹¹In/¹²⁵I/^99mTc]-(HE)₃-Z_HER2:342-C, [¹¹¹In/¹²⁵I/^99mTc]-H₆-Z_HER2:342-C, and [¹¹¹In/¹²⁵I/^99mTc]-Z_HER2:342-H₆-C
    Arvind Chopra.
    Created: July 16, 2012; Last Update: August 9, 2012.
  - ¹¹¹In/⁸⁶Y-Labeled F(ab')₂ fragment of panitumumab, a fully human monoclonal antibody directed against the extracellular domain III of the epidermal growth factor receptor [PDF Version]
    [¹¹¹In/⁸⁶Y]-CHX-A''-Panitumumab F(ab')₂
    Arvind Chopra.
    Created: April 30, 2012; Last Update: June 21, 2012.
  - ¹¹¹In-(1-isothiocyanatobenzyl-3-methyldiethylenetriaminepentaaetic acid)-anti–TAG-72 humanized C_H2 domain-deleted antibody [PDF Version]
    ¹¹¹In-(Mx-DTPA)-HuCC49ΔC_H2 Ab
    Kenneth T. Cheng.
    Created: August 17, 2007; Last Update: February 12, 2008.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-Ac-RWQPCPAESWT-Cha-CWDPGGGK-NH₂ (FibPep) [PDF Version]
    ¹¹¹In-DOTA-FibPep
    Kam Leung.
    Created: May 7, 2013; Last Update: May 30, 2013.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-1,4,7,10-tetraacetic acid-anti-insulin-like growth factor 1 receptor Affibody Z_IGF1R:4551 [PDF Version]
    ¹¹¹In-DOTA-Z_IGF1R:4551
    Kam Leung.
    Created: January 20, 2012; Last Update: March 29, 2012.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-1,4,7,10-triacetic acid-8-aminooctanoic acid-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ¹¹¹In-DOTA-8-Aoc-BBN[7-14]NH₂
    Kam Leung.
    Created: June 20, 2012; Last Update: October 4, 2012.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-1,4,7-triacetic acid-L-homoalanine [PDF Version]
    ¹¹¹In-DO3A-H
    Kam Leung.
    Created: January 12, 2013; Last Update: March 28, 2013.
  - ¹¹¹In-1,4,7,10-tetraazacyclododecane-1,4,7-tris-acetic acid-10-maleimidoethylacetamide-Affibody Z_HER2:2395-Cys [PDF Version]
    ¹¹¹In-[MMA-DOTA-Cys⁶¹]-Z₂₃₉₅-C
    Kam Leung.
    Created: August 16, 2009; Last Update: November 19, 2009.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-AB.Fab4D5 [PDF Version]
    ¹¹¹In-DOTA-AB.Fab4D5
    Kam Leung.
    Created: April 16, 2007; Last Update: November 8, 2007.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid- Affibody Z_{HER2:342-pep2} [PDF Version]
    ¹¹¹In-DOTA-Z_{HER2:342-pep2}
    Kam Leung.
    Created: April 16, 2007; Last Update: June 27, 2007.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-cyclo(D-diaminobutyric acid-Arg-Phe-Phe-D-Trp-Lys-Thr-Phe) [PDF Version]
    ¹¹¹In-KE88
    Kam Leung.
    Created: September 1, 2009; Last Update: October 8, 2009.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-LLP2A [PDF Version]
    ¹¹¹In-DOTA-LLP2A
    Kam Leung.
    Created: June 10, 2009; Last Update: August 12, 2009.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-T84.66 diabody [PDF Version]
    ¹¹¹In-DOTA-T84.66 diabody
    Kam Leung.
    Created: February 2, 2008; Last Update: March 6, 2008.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-T84.66 minibody [PDF Version]
    ¹¹¹In-DOTA-T84.66 minibody
    Kam Leung.
    Created: February 2, 2008; Last Update: March 6, 2008.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-T84.66 scFv-human serum albumin [PDF Version]
    ¹¹¹In-DOTA-T84.66 scFv-HSA
    Kam Leung.
    Created: July 2, 2008; Last Update: September 2, 2008.
  - ¹¹¹In-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-NDECELCVNVACTGCL [PDF Version]
    ¹¹¹In-DOTA-E³-uroguanylin
    Kam Leung.
    Created: April 16, 2010; Last Update: June 25, 2010.
  - ¹¹¹In-1,4,7-Triazacyclononane,1-glutaric acid-4,7-acetic acid-Glu-[cyclo(Arg-Gly-Asp-d-Phe-Lys)]₂ [PDF Version]
    ¹¹¹In-NODAGA-E-[c(RGDfK)]₂
    Kam Leung.
    Created: May 5, 2013; Last Update: June 13, 2013.
  - ¹¹¹In-2-(4,7,10-Tris(carboxymethyl)-1,4,7,10-tetracyclododecan-1-yl)pentanedioic acid-Trastuzumab [PDF Version]
    ¹¹¹In-DOTAGA-Trastuzumab
    Kam Leung.
    Created: May 23, 2012; Last Update: September 13, 2012.
  - ¹¹¹In-2-(p-isothiocyanatobenzyl)-6-methyl-diethylenetriamine-N,N,N´,N´´,N´´-pentaacetic acid-trastuzumab [PDF Version]
    ¹¹¹In-1B4M-DTPA-humAb4D5-8
    Kenneth T. Cheng.
    Created: May 1, 2008; Last Update: June 4, 2008.
  - ¹¹¹In-Anti-CD105 MJ7/18 monoclonal antibody [PDF Version]
    ¹¹¹In-MJ7/18 MAb
    Kenneth T. Cheng.
    Created: July 4, 2006; Last Update: December 21, 2007.
  - ¹¹¹In-Benzyl-diethylenetriamine pentaacetic acid-AMB8LK [PDF Version]
    ¹¹¹In-DTPA-AMB8LK
    Kam Leung.
    Created: May 24, 2007; Last Update: February 1, 2007.
  - ¹¹¹In-Benzyl-diethylenetriaminepentaacetic acid-Z_HER2:342 [PDF Version]
    ¹¹¹In-Benzyl-DTPA-Z_HER2:342
    Kam Leung.
    Created: April 6, 2008; Last Update: May 30, 2008.
  - ¹¹¹In-Benzyl-tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-Z_HER2:342 [PDF Version]
    ¹¹¹In-Benzyl-DOTA-Z_HER2:342
    Kam Leung.
    Created: April 6, 2008; Last Update: May 29, 2008.
  - ¹¹¹In-BZ-Diethylenetriaminepentaacetic acid-Z_EGFR:1907 [PDF Version]
    Kam Leung.
    Created: April 6, 2009; Last Update: June 24, 2009.
  - ¹¹¹In-Capromab pendetide [PDF Version]
    ¹¹¹In-CYT-356
    Kam Leung.
    Created: October 5, 2005; Last Update: May 24, 2008.
  - ¹¹¹In-CHX-A''-DTPA-anti-mindin/RG-1 monoclonal antibody 19G9 [PDF Version]
    ¹¹¹In-CHX-A''-DTPA-19G9
    Kam Leung.
    Created: November 16, 2009; Last Update: December 3, 2009.
  - ¹¹¹In-CHX-A”-diethylenepentaacetic acid-Affibody Z_HER2:2395-Cys [PDF Version]
    ¹¹¹In-CHX-A’’-DTPA-Z₂₃₉₅-C
    Kam Leung.
    Created: August 16, 2009; Last Update: November 19, 2009.
  - ¹¹¹In-CHX-A”-Diethylenetriamine pentaacetic acid-(Z_EGFR:955)₂ [PDF Version]
    ¹¹¹In-CHX-A”-DTPA-(Z_EGFR:955)₂
    Kam Leung.
    Created: June 6, 2008; Last Update: July 15, 2008.
  - ¹¹¹In-CHX-A”-Rhenium-cyclized-[Cys^3,4,10,D-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ¹¹¹In-CHX-A”-ReCCMSH(Arg¹¹)
    Kam Leung.
    Created: August 20, 2009; Last Update: May 9, 2012.
  - ¹¹¹In conjugated to benzyl-diethylenetriaminepentaacetic acid-human epidermal growth factor [PDF Version]
    [¹¹¹In]Bz-DTPA-hEGF
    Arvind Chopra.
    Created: February 4, 2009; Last Update: February 25, 2009.
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-2-(p-isothiocyanatobenzyl)-6-methyl-B3 monoclonal antibody [PDF Version]
    ¹¹¹In-DTPA-1B4M-B3
    Kam Leung.
    Created: March 17, 2009; Last Update: May 13, 2009.
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-2C5 monoclonal antibody [PDF Version]
    ¹¹¹In-DTPA-2C5
    Kam Leung.
    Created: May 17, 2009; Last Update: June 6, 2009.
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-aminohexanoic acid-Lys⁴⁰-exendin-4 [PDF Version]
    ¹¹¹In-DTPA-Ahx-Lys⁴⁰-exendin-4
    Kam Leung.
    Created: January 17, 2007; Last Update: January 30, 2012.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-anti-epithelial glycoprotein-1 hRS7 humanized monoclonal antibody [PDF Version]
    ¹¹¹In-DTPA-hRS7
    Kam Leung.
    Created: January 12, 2012; Last Update: April 19, 2012.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-Anti-ligand–induced binding sites (LIBS) single-chain (scFv) antibody [PDF Version]
    ¹¹¹In-DTPA-LIBS-scFv
    Kam Leung.
    Created: November 23, 2012; Last Update: January 31, 2013.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-bevacizumab [PDF Version]
    ¹¹¹In-DTPA-bevacizumab
    Kam Leung.
    Created: October 17, 2008; Last Update: December 16, 2008.
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-cyclo(CTTHWGFTLC) [PDF Version]
    ¹¹¹In-DTPA-CTT
    Kam Leung.
    Created: January 17, 2007; Last Update: April 25, 2012.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-human anti-insulin-like growth factor 1 receptor monoclonal antibody R1507 [PDF Version]
    ¹¹¹In-DTPA-R1507
    Kam Leung.
    Created: December 20, 2010; Last Update: February 3, 2011.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-human epidermal growth factor [PDF Version]
    ¹¹¹In-DTPA-hEGF
    Arvind Chopra.
    Created: December 4, 2007; Last Update: January 22, 2008.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-IC2 rat monoclonal autoantibody to pancreatic β-cell surface antigen [PDF Version]
    ¹¹¹In-DTPA-IC2
    Kam Leung.
    Created: November 3, 2011; Last Update: February 2, 2012.
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-Lys⁴⁰-exendin-3 [PDF Version]
    ¹¹¹In-DTPA-Lys⁴⁰-exendin-3
    Kam Leung.
    Created: August 20, 2010; Last Update: November 3, 2010.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-NAVPNLRGDLQVLAQKVART [PDF Version]
    ¹¹¹In-DTPA-A20FMDV2
    Kam Leung.
    Created: September 6, 2012; Last Update: November 29, 2012.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-pertuzumab [PDF Version]
    ¹¹¹In-DTPA-pertuzumab
    Kam Leung.
    Created: December 6, 2009; Last Update: January 21, 2010.
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-polyethylene glycol-annexin V [PDF Version]
    ¹¹¹In-DTPA-PEG-Anx5
    Kenneth T. Cheng.
    Created: September 28, 2006; Last Update: January 9, 2008.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-QKYGNQWAVGHLM-NH₂ [PDF Version]
    ¹¹¹In-[DTPA¹-Lys³,Tyr⁴]-BN
    Kam Leung.
    Created: April 21, 2010; Last Update: June 25, 2010.
  - ¹¹¹In-Diethylenetriamine pentaacetic acid-single-walled nanotubes [PDF Version]
    ¹¹¹In-DTPA-SWNTs
    Kam Leung.
    Created: September 26, 2008; Last Update: November 17, 2008.
  - ¹¹¹In-Diethylenetriaminepentaacetic acid-trastuzumab [PDF Version]
    ¹¹¹In-DTPA-humAb4D5-8
    Kenneth T. Cheng.
    Created: March 1, 2006; Last Update: June 4, 2008.
  - ¹¹¹Indium-diethylenetriaminepentaacetic acid-d-phenylalanine-octreotide [PDF Version]
    ¹¹¹In-DTPA-OC
    The MICAD Research Team.
    Created: January 23, 2005; Last Update: August 25, 2005.
  - ¹¹¹Indium-diethylenetriaminepentaacetic acid-folate [PDF Version]
    ¹¹¹In-DTPA-folate
    Kam Leung.
    Created: April 1, 2005; Last Update: January 29, 2011.
  - ¹¹¹In-DOTA-4-amino-1-carboxymethyl-piperidine-D-Phe-Gln-Trp-Ala-Val-Gly-His-Sta-Leu-NH₂ [PDF Version]
    ¹¹¹In-RM2
    Kam Leung.
    Created: February 5, 2011; Last Update: May 4, 2011.
  - ¹¹¹In-DOTA-Gly-benzoyl-D-Phe-Gln-Trp-Ala-Val-Gly-His-Sta-Leu-NH₂ [PDF Version]
    ¹¹¹In-RM1
    Kam Leung.
    Created: November 5, 2009; Last Update: January 30, 2011.
  - ¹¹¹In-DOTA-Re(Cys^3,4,10,d-Phe⁷,Arg¹¹)αMSH_3-13 [PDF Version]
    ¹¹¹In-DOTA-Re(Arg¹¹)CCMSH
    Kenneth T. Cheng, Zhen Cheng, and Thomas P. Quinn.
    Created: September 1, 2007; Last Update: December 17, 2007.
  - ¹¹¹In-DPC11870 [PDF Version]
    ¹¹¹In-DPC11870
    Arvind Chopra.
    Created: March 7, 2007; Last Update: December 19, 2008.
  - ¹¹¹In-DTPA-Poly(ethylene glycol)-anti-epidermal growth factor receptor antibody C225 [PDF Version]
    ¹¹¹In-DTPA-PEG-C225
    The MICAD Research Team.
    Created: June 7, 2007; Last Update: July 2, 2007.
  - ¹¹¹In-Ibritumomab tiuxetan [PDF Version]
    ¹¹¹In-2B8 MAb
    The MICAD Research Team.
    Created: November 22, 2005; Last Update: September 26, 2007.
  - ¹¹¹In-Labeled (7S)-26-(4-((1-((1-carboxy-5-(2-(4,7,10-tris(carboxymethyl)-1,4,7,10-tetraazacyclododecan-1-yl)acetamido)pentyl)amino)-1-oxo-6-(1-((7S)-1,3,7,22-tetracarboxy-5,13,20-trioxo-4,6,12,21-tetraazahexacosan-26-yl)-1H-1,2,3-triazole-4-carboxamido)hexan-2-yl)carbamoyl)-1H-1,2,3-triazol-5-yl)-5,13,20-trioxo-4,6,12,21-tetraazahexacosane-1,3,7,22-tetracarboxylic acid [PDF Version]
    [¹¹¹In]3
    Liang Shan.
    Created: October 31, 2012; Last Update: December 19, 2012.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-conjugated dimeric [Tyr³]octreotide [PDF Version]
    ¹¹¹In-Dimeric [Tyr³]octreotide
    Liang Shan.
    Created: November 14, 2010; Last Update: December 28, 2010.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-conjugated monomeric [Tyr³]octreotide [PDF Version]
    ¹¹¹In-Monomeric [Tyr³]octreotide
    Liang Shan.
    Created: November 14, 2010; Last Update: December 28, 2010.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-regioselectively addressable functionalized template-[cyclo-(Arg-Gly-Asp-d-Phe-Lys)]₄ [PDF Version]
    ¹¹¹In-DOTA-RAFT-RGD
    Liang Shan.
    Created: July 17, 2012; Last Update: August 29, 2012.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH₂ with a disulfide bridge between the two homoC [PDF Version]
    ¹¹¹In-DOTA-MUT-DS
    Liang Shan.
    Created: November 15, 2011; Last Update: December 21, 2011.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetracetic acid-Glu{PEG₄-Glu[cyclo(Lys(Gly-Gly-Gly)-Arg-Gly-Asp-d-Phe)]-cyclo(Lys(Gly-Gly-Gly)-Arg-Gly-Asp-d-Phe)}-{PEG₄-Glu[cyclo(Lys(Gly-Gly-Gly)-Arg-Gly-Asp-d-Phe)]-cyclo(Lys(Gly-Gly-Gly)-Arg-Gly-Asp-d-Phe)} (PEG₄ = 15 amino-4,7,10,13-tetraoxapentadecanoic acid) [PDF Version]
    ¹¹¹In(DOTA-2P4G-RGD₄)
    Liang Shan.
    Created: February 23, 2012; Last Update: March 22, 2012.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetracetic acid-Glu{PEG₄-Glu[cyclo(Lys(PEG₄)-Arg-Gly-Asp-d-Phe)]-cyclo(Lys(PEG₄)-Arg-Gly-Asp-d-Phe)}-{PEG₄-Glu[cyclo(Lys(PEG₄)-Arg-Gly-Asp-d-Phe)]-cyclo(Lys(PEG₄)-Arg-Gly-Asp-d-Phe)} (PEG₄ = 15 amino-4,7,10,13-tetraoxapentadecanoic acid) [PDF Version]
    ¹¹¹In(DOTA-6P-RGD₄)
    Liang Shan.
    Created: February 23, 2012; Last Update: March 22, 2012.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetracetic acid-Glu{PEG₄-Glu[cyclo(Lys-Arg-Gly-Asp-d-Phe)]-cyclo(Lys-Arg-Gly-Asp-d-Phe)}-{PEG₄-Glu[cyclo(Lys-Arg-Gly-Asp-d-Phe)]-cyclo(Lys-Arg-Gly-Asp-d-Phe)} (PEG₄ = 15 amino-4,710,13-tetraoxapentadecanoic acid) [PDF Version]
    ¹¹¹In(DOTA-2P-RGD₄)
    Liang Shan.
    Created: February 23, 2012; Last Update: March 22, 2012.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid (DOTA)-d-Tyr-d-Lys(HSG)-d-Glu-d-Lys(HSG)-NH₂ (IMP-288) [PDF Version]
    [¹¹¹In]-IMP-288
    Arvind Chopra.
    Created: June 29, 2011; Last Update: August 25, 2011.
  - ¹¹¹In-Labeled 1,4,7,10-tetraazacyclododecane-N,N’,N”,N’”-tetraacetic acid-GSC(succinimidopropionyl-EAYGWNleDF-NH₂)-EAYGWNleDF-NH₂ [PDF Version]
    ¹¹¹In-MGD5
    Arvind Chopra.
    Created: January 8, 2010; Last Update: February 18, 2010.
  - ¹¹¹In-Labeled Ac-Phe-Lys(DTPA)-Tyr-Lys(DTPA)-NH₂ (IMP-156) [PDF Version]
    [¹¹¹In]-IMP-156
    Arvind Chopra.
    Created: June 27, 2011; Last Update: July 27, 2011.
  - ¹¹¹In-Labeled affibody ABY-025 targeting epidermal growth factor receptor 2 [PDF Version]
    [¹¹¹In]-ABY-025
    Arvind Chopra.
    Created: July 27, 2010; Last Update: August 27, 2010.
  - ¹¹¹In-Labeled anti-CD44v6 chimeric monoclonal antibody U36 [PDF Version]
    ¹¹¹In-cMAb U36
    Arvind Chopra.
    Created: July 22, 2008; Last Update: August 14, 2008.
  - ¹¹¹In-Labeled anti-epidermal growth factor receptor Affibody PEP09239 [PDF Version]
    [¹¹¹In]PEP09239
    Arvind Chopra.
    Created: March 28, 2013; Last Update: May 2, 2013.
  - ¹¹¹In-Labeled anti-epidermal growth factor receptor human monoclonal antibody 048-006 [PDF Version]
    [¹¹¹In]-048-006
    Arvind Chopra.
    Created: October 10, 2012; Last Update: November 8, 2012.
  - ¹¹¹In-Labeled chimeric monoclonal antibody, ch806, targeting the epidermal growth factor receptor deletion variant de2-7 (EGFRvIII) [PDF Version]
    [¹¹¹In]-ch806
    Arvind Chopra.
    Created: July 6, 2010; Last Update: August 26, 2010.
  - ¹¹¹In-Labeled CHX-A''-DTPA–conjugated MORAb-009, a chimeric monoclonal antibody directed against mesothelin [PDF Version]
    [¹¹¹In]MORAb-009
    Arvind Chopra.
    Created: January 10, 2012; Last Update: February 2, 2012.
  - ¹¹¹In-Labeled CHX-A”-DTPA conjugated monoclonal antibody (mAb) 806 targeting the epidermal growth factor receptor deletion variant de2-7 (EGFRvIII) [PDF Version]
    [¹¹¹In]-mAb806
    Arvind Chopra.
    Created: July 1, 2010; Last Update: August 5, 2010.
  - ¹¹¹In-Labeled diethylenetriamine-pentaacetic acid-Ac-TZ14011 [PDF Version]
    [¹¹¹In]Ac-TZ14011
    Arvind Chopra.
    Created: June 10, 2009; Last Update: July 7, 2009.
  - ¹¹¹In-Labeled DOTA-conjugated 6-aminohexanoic linker-containing variant of anti-epidermal growth factor receptor 2 Affibody Z_HER2:342 (ABY-003) [PDF Version]
    [¹¹¹In]-ABY-003
    Arvind Chopra.
    Created: July 8, 2011; Last Update: August 23, 2011.
  - ¹¹¹In-Labeled DOTA-conjugated sCCK8[Phe²(p-CH₂SO₃H),Nle^3,6], a sulfated cholecystokinin 8 (sCCK8) peptide derivative [PDF Version]
    [¹¹¹In]sCCK8[Phe²(p-CH₂SO₃H),Nle^3,6
    Arvind Chopra.
    Created: January 7, 2013; Last Update: January 31, 2013.
  - ¹¹¹In-Labeled DTPA conjugated anti-c-kit monoclonal antibody 12A8 Fab fragment [PDF Version]
    [¹¹¹In]12A8 Fab
    Arvind Chopra.
    Created: June 9, 2011; Last Update: June 30, 2011.
  - ¹¹¹In-Labeled DTPA conjugated monoclonal antibody 12A8 that targets the c-kit receptor [PDF Version]
    [¹¹¹In]12A8
    Arvind Chopra.
    Created: June 9, 2011; Last Update: June 30, 2011.
  - ¹¹¹In-Labeled DTPA-conjugated Tat-linked anti-phosphorylated histone protein H2AX antibody [PDF Version]
    [¹¹¹In]-DTPA-anti-γH2AX-Tat
    Arvind Chopra.
    Created: July 28, 2011; Last Update: August 25, 2011.
  - ¹¹¹In-Labeled human serum albumin–conjugated Affibody Z_HER2:342 that targets the human epidermal growth factor receptor 2 (HER2) [PDF Version]
    [¹¹¹In]-DOTA-HSA-Z_HER2:342
    Arvind Chopra.
    Created: May 19, 2011; Last Update: June 1, 2011.
  - ¹¹¹In-Labeled lexatumumab [PDF Version]
    ¹¹¹ln-EC-HGS-ETR2
    Arvind Chopra.
    Created: March 19, 2009; Last Update: May 20, 2009.
  - ¹¹¹In-Labeled mapatumumab [PDF Version]
    ¹¹¹In-EC-HGS-ETR1
    Arvind Chopra.
    Created: March 16, 2009; Last Update: May 20, 2009.
  - ¹¹¹In-Labeled MLS128 anti-Tn murine monoclonal antibody [PDF Version]
    ¹¹¹In-MLS128
    Liang Shan.
    Created: July 21, 2009; Last Update: August 25, 2009.
  - ¹¹¹In-Labeled panitumumab, a fully human monoclonal antibody directed against the extracellular domain III of the epidermal growth factor receptor [PDF Version]
    [¹¹¹In]-Panitumumab
    Arvind Chopra.
    Created: April 24, 2012; Last Update: June 21, 2012.
  - ¹¹¹In-Labeled recombinant gelonin toxin-B lymphocyte stimulator protein fusion protein [PDF Version]
    [¹¹¹In]-DTPA-rGel/BLyS
    Arvind Chopra.
    Created: February 22, 2011; Last Update: March 31, 2011.
  - ¹¹¹In-p-Benzyl isothiocyanate-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-14C5 monoclonal antibody [PDF Version]
    ¹¹¹In-p-SCN-Bz-DOTA-14C5
    Kam Leung.
    Created: April 20, 2013; Last Update: May 16, 2013.
  - ¹¹¹In-Streptavidin-biotinylated α-melanocyte-stimulating hormone 2.0 bacteriophage [PDF Version]
    ¹¹¹In-SA-α-MSH2.0 phage
    Kenneth T. Cheng.
    Created: March 28, 2007; Last Update: May 5, 2008.
  - ¹¹¹In-TA138 [PDF Version]
    RP748
    Kam Leung.
    Created: October 17, 2005; Last Update: March 11, 2011.
  - ¹¹¹In-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-c(D-Cys-Phe-Tyr-D-AgI⁸(Me,2-naphthoyl)-Lys-Thr-Phe-Cys)-OH [PDF Version]
    ¹¹¹In-DOTA-sst₃-ODN-8
    Kam Leung.
    Created: August 5, 2009; Last Update: October 15, 2009.
  - ¹¹¹In-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-[cyclo(Arg-Gly-Asp-D-Phe-Lys)]₂ [PDF Version]
    ¹¹¹In-DOTA-E-[c(RGDfK)]₂
    Kam Leung.
    Created: August 20, 2007; Last Update: September 15, 2007.
  - ¹¹¹In-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-{Glu-[cyclo(Arg-Gly-Asp-D-Phe-Lys)]₂}₂ [PDF Version]
    ¹¹¹In-DOTA-E-{E-[c(RGDfK)]₂}₂
    Kam Leung.
    Created: August 19, 2007; Last Update: September 15, 2007.
  - ¹¹¹In-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Glu-cyclo(Arg-Gly-Asp-D-Phe-Lys) [PDF Version]
    ¹¹¹In-DOTA-E-c(RGDfK)
    Kam Leung.
    Created: August 6, 2007; Last Update: September 17, 2007.
  - ¹¹¹In-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-MEDI-522 [PDF Version]
    ¹¹¹In-DOTA-MEDI-522
    Kam Leung.
    Created: June 6, 2011; Last Update: June 30, 2011.
  - ¹¹¹In-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-Phe(4-NO₂)-cyclo(D-Cys-Tyr-D-Trp-Lys-Thr-Cys)-D-Tyr-NH₂ [PDF Version]
    ¹¹¹In-DOTA-sst₂-ANT
    Kam Leung.
    Created: September 5, 2009; Last Update: October 15, 2009.
  - ¹¹¹In-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-(GSG)-ANTPCGPYTHDCPVKR [PDF Version]
    ¹¹¹In-DOTA(GSG)-G3-C12
    Kam Leung.
    Created: April 17, 2009.
  - ¹¹¹In-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-Asp–Tyr(SO₃H)–Met–Gly–Trp–Met–Asp–Phe–NH₂ [PDF Version]
    ¹¹¹In-DOTA-sCCK8
    Kam Leung.
    Created: December 17, 2007; Last Update: February 28, 2008.
  - ¹¹¹In-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid- d-Glu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH₂ [PDF Version]
    ¹¹¹In-DOTA-minigastrin
    Kam Leung.
    Created: February 17, 2008; Last Update: May 8, 2008.
  - ¹¹¹In-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-dihistidine-norleucine peptide analog [PDF Version]
    ¹¹¹In-DOTA-H2-Nle
    Kenneth T. Cheng.
    Created: August 8, 2007; Last Update: December 11, 2007.
  - ¹¹¹In-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-HHEAYGWMDF-NH₂ peptide [PDF Version]
    ¹¹¹In-DOTA-H2-Met
    Kenneth T. Cheng.
    Created: April 23, 2007; Last Update: April 3, 2008.
  - ¹¹¹In-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-HHHHHH-EAYGWMDF-NH₂ peptide [PDF Version]
    ¹¹¹In-DOTA-H6-Met
    Kenneth T. Cheng.
    Created: April 23, 2007; Last Update: April 3, 2008.
  - ¹¹¹In-Tetrameric Plectin-1 targeting peptide (4(βAKTLLPTP-GGS(PEG5000))KKK-¹¹¹In-DOTA-βA-NH₂) [PDF Version]
    ¹¹¹In-tPTP
    Kam Leung.
    Created: January 28, 2011; Last Update: April 27, 2011.
  - ¹¹¹In-Trastuzumab Fab [PDF Version]
    ¹¹¹In-humAb4D5-8 Fab
    The MICAD Research Team.
    Created: March 13, 2006; Last Update: April 18, 2006.
  - 4-[2-(3,4,5,6-Tetrahydropyrimidin-2-ylamino)ethyloxy]benzoyl-2-(S)-[N-3-amino-(SCN-Bz-DOTA-¹¹¹In)-neopenta-1-carbamyl)]-aminoethylsulfonylamino-β-alanine [PDF Version]
    IAC-SCN-Bz-DOTA-¹¹¹In
    Kenneth T. Cheng, Chang H. Paik, and Narasimhan Danthi.
    Created: July 9, 2007; Last Update: December 18, 2007.
  - Anti-mouse monoclonal antibody immunoglobulin G conjugated to GRKKRRQRRRPPQGYG-diethylenetriamine pentaacetic acid-[¹¹¹In] [PDF Version]
    [¹¹¹In]mIgG-tat peptide
    Arvind Chopra.
    Created: January 16, 2008; Last Update: February 20, 2008.
  - Biotinylated anti-Tn MLS128 monoclonal antibody-streptavidin-¹¹¹In-DTPA-biotin [PDF Version]
    Bt-MLS128-SA-¹¹¹In-biotin
    Liang Shan.
    Created: July 21, 2009; Last Update: September 17, 2009.
  - Lys-cys-cys-tyr-ser-leu-(gly-ser-gly)-1,4,7,10-tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-¹¹¹In [PDF Version]
    ¹¹¹In-DOTA-(GSG)-KCCYSL
    Arvind Chopra.
    Created: November 8, 2007; Last Update: December 12, 2007.
  - Single-walled carbon nanotubes-¹¹¹In-1,4,7,10-tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-rituximab [PDF Version]
    CNT-([¹¹¹In]DOTA)(Rituximab)
    Kenneth T. Cheng, Michael R. McDevitt, and David A. Scheinberg.
    Created: August 21, 2007; Last Update: December 21, 2007.
  - TA138-conjugated ¹¹¹In nanoparticles [PDF Version]
    α_vβ₃-targeted ¹¹¹In/NP
    Arvind Chopra.
    Created: October 22, 2007; Last Update: November 13, 2007.
- 123I
  - (1-Butyl-4-piperidinylmethyl)-8-amino-7-[¹²³I]iodo-1,4-benzodioxan-5-carboxylate [PDF Version]
    [¹²³I]SB207710
    Kam Leung.
    Created: April 22, 2009; Last Update: June 5, 2009.
  - [¹²³I]-2-Iodo-2-amino-3-phenylpropanoic acid [PDF Version]
    2-[¹²³I]I-L-PA
    Arvind Chopra.
    Created: June 3, 2008; Last Update: July 3, 2008.
  - [¹²³I]Iomazenil [PDF Version]
    [¹²³I]IMZ
    The MICAD Research Team.
    Created: March 22, 2005; Last Update: October 5, 2005.
  - [¹²³I]Vascular endothelial growth factor [PDF Version]
    [¹²³I]VEGF₁₆₅
    Kam Leung.
    Created: April 18, 2005; Last Update: August 16, 2005.
  - [¹²³I]-β-Methyl iodophenyl-pentadecanoic acid [PDF Version]
    [¹²³I]-BMIPP
    Arvind Chopra.
    Created: February 12, 2008; Last Update: December 19, 2008.
  - 1-(2,4-Dichlorophenyl)-5-(4-[¹²³I]iodophenyl)-4-methyl-1H-pyrazole-3-carboxylic acid N',N'-dimethyl-hydrazide [PDF Version]
    [¹²³I]Me₂Pyr
    Kam Leung.
    Created: March 5, 2007; Last Update: March 13, 2007.
  - 1(trans-[¹²³I]Iodopropen-2-yl)-4-[(4-cyanophenoxy)methyl]piperidine [PDF Version]
    [¹²³I]TPCNE
    Kenneth T. Cheng.
    Created: January 5, 2007; Last Update: June 2, 2008.
  - ^123/131I-Fab and F(ab')₂ fragments of anti-integrin α_vβ₅ monoclonal antibody 14C5 [PDF Version]
    ^123/131I-Fab/F(ab')₂-14C5
    Kam Leung.
    Created: March 20, 2013; Last Update: May 23, 2013.
  - ¹²³I-Annexin V [PDF Version]
    ¹²³I-Anx5
    Kenneth T. Cheng.
    Created: August 15, 2006; Last Update: December 18, 2007.
  - ¹²³I-Anti-vascular cell adhesion molecule monoclonal antibody 5F10 [PDF Version]
    ¹²³I-5F10
    Kam Leung.
    Created: September 27, 2007; Last Update: October 29, 2007.
  - ¹²³I-Arg-Glu-Asn-Leu-Arg-Ile-Ala-Leu-Arg-Tyr [PDF Version]
    ¹²³I-B2702-p
    Kam Leung.
    Created: September 6, 2007; Last Update: November 15, 2007.
  - ¹²³I-c(RGDfK)-human serum albumin-tissue inhibitor of matrix metalloproteinase 2 fusion protein [PDF Version]
    ¹²³I-RGD-HSA-TIMP2
    Kam Leung.
    Created: February 10, 2012; Last Update: May 24, 2012.
  - ¹²³I-Interleukin-2 [PDF Version]
    ¹²³I-IL-2
    Kam Leung.
    Created: April 29, 2005; Last Update: August 16, 2005.
  - ¹²³I-Labeled (S)-2-(3-((S)-1-carboxy-5-(3-(4-iodophenyl) ureido)pentyl)ureido)pentanedoic acid [PDF Version]
    [¹²³I]MIP-1095
    Arvind Chopra.
    Created: September 29, 2009; Last Update: November 24, 2009.
  - ¹²³I-Labeled (S)-2-(3-((S)-1-carboxy-5-(4-iodobenzylamino)pentyl)ureido)pentanedoic acid [PDF Version]
    [¹²³I]MIP-1072
    Arvind Chopra.
    Created: September 29, 2009; Last Update: November 24, 2009.
  - 2-(2-(4-(4-[¹²³I]Iodobenzyl)piperazin-1-yl)-2-oxoethyl)isoindoline-1,3-dione [PDF Version]
    [¹²³I]MEL037
    Kenneth T. Cheng and Andrew Katsifis.
    Created: July 31, 2007; Last Update: January 31, 2008.
  - 2β-Carbomethoxy-3β-(4´-((Z)-2-[¹²³I]iodoethenyl)phenyl)nortropane [PDF Version]
    [¹²³I]pZIENT
    Jeffrey Stehouwer and Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - 5-[¹²³I]Iodo-3-[2(S)-2-azetidinylmethoxy]pyridine [PDF Version]
    5-[¹²³I]IA
    Kam Leung.
    Created: July 7, 2006; Last Update: July 24, 2006.
  - 6-Chloro-2-(4'-[¹²³I]iodophenyl)-3-(N,N-diethyl)imidazo[1,2-a]pyridine-3-acetamide [PDF Version]
    [¹²³I]CLINDE
    Kam Leung.
    Created: January 12, 2008; Last Update: February 18, 2008.
  - 7-(2-(4-(2-Fluoro-4-[¹²³I]iodophenyl)piperazin-1-yl)ethyl)-2-(furan-2-yl)-7H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-5-amine [PDF Version]
    [¹²³I]MNI-420
    Arvind Chopra.
    Created: April 22, 2013; Last Update: June 27, 2013.
  - 8-[¹²³I]Iodo-L-1,2,3,4-tetrahydro-7-hydroxyisoquinoline-3-carboxylic acid [PDF Version]
    [¹²³I]ITIC
    Kam Leung.
    Created: February 22, 2007; Last Update: May 12, 2008.
  - Mono-[¹²³I]Iodohypericin [PDF Version]
    [¹²³I]MIH
    Arvind Chopra.
    Created: February 6, 2008; Last Update: March 12, 2008.
  - Mono-[¹²³I]iodohypericine monocarboxylic acid [PDF Version]
    [¹²³I]MIHA
    Arvind Chopra.
    Created: February 21, 2008; Last Update: June 2, 2008.
  - N-(2-(Diethylamino)ethyl)-5-[¹²³I]iodonicotinamide [PDF Version]
    [¹²³I]MEL008
    Kam Leung.
    Created: October 7, 2009; Last Update: March 4, 2010.
  - N-(3-Fluoropropyl)-2β-carbomethoxy-3β-(4-[¹²³I]iodophenyl)nortropane [PDF Version]
    [¹²³I]FP-CIT
    Kam Leung.
    Created: December 16, 2004; Last Update: February 1, 2011.
  - N-(Morpholin-4-yl)-5-(4-[¹²³I]iodophenyl)-1-(2,4-dichlorophenyl)-4-methyl-1H-pyrazole-3-carboxamide [PDF Version]
    [¹²³I]AM281
    Kam Leung.
    Created: December 5, 2006; Last Update: January 31, 2008.
- 123I,125I
  - [¹²³I/¹²⁵I]6-Iodo-2-(4´-dimethylamino)-phenyl-imidazo[1,2-a]pyridine [PDF Version]
    [^123,125I]IMPY
    The MICAD Research Team.
    Created: April 18, 2005; Last Update: May 12, 2006.
  - ¹²⁵I-Labeled chimeric monoclonal antibody, ch806, targeting the epidermal growth factor receptor deletion variant de2-7 (EGFRvIII) [PDF Version]
    [¹²⁵I]-ch806
    Arvind Chopra.
    Created: July 6, 2010; Last Update: August 26, 2010.
  - ¹²⁵I-Labeled monoclonal antibody (mAb) 806 targeting the epidermal growth factor receptor deletion variant de2-7 (EGFRvIII) [PDF Version]
    [¹²⁵I]-mAb806
    Arvind Chopra.
    Created: July 1, 2010; Last Update: August 5, 2010.
  - 2-((2-((Dimethylamino)methyl)phenyl)thio)-5-[¹²³I]iodophenylamine [PDF Version]
    Radioiodinated ADAM
    The MICAD Research Team.
    Created: August 6, 2007; Last Update: September 6, 2007.
  - Radioiodinated N-(2-diethylaminoethyl)-6-iodoquinoxaline-2-carboxamide dihydrochloride salt [PDF Version]
    [¹²⁵I]ICF01012
    Liang Shan.
    Created: August 5, 2011; Last Update: September 28, 2011.
- 123I, 131I
  - ^123/131I-Anti-cellular adhesion molecule monoclonal antibody 14C5 [PDF Version]
    ^123/131I-mAb 14C5
    Kam Leung.
    Created: June 11, 2007; Last Update: February 20, 2013.
  - ¹³¹I-Labeled arginine-arginine-leucine (RRL)-containing cyclic peptide (YCGGRRLGGC) for imaging prostate carcinoma [PDF Version]
    ¹³¹I-Labeled RRL peptide
    Liang Shan.
    Created: January 6, 2010; Last Update: February 16, 2010.
- 123I/125I/131I
  - Meta-[radioiodinated]iodobenzylguanidine [PDF Version]
    [¹²³I/¹²⁵I/¹³¹I]MIBG
    The MICAD Research Team.
    Created: May 3, 2007; Last Update: July 3, 2007.
- 125I
  - (2S,αS)-2-(α-(2-[¹²⁵I]Iodophenoxy)benzyl)morpholine [PDF Version]
    [¹²⁵I]IPBM
    Kam Leung.
    Created: February 19, 2009; Last Update: May 15, 2009.
  - [¹²⁵I](E)-N-1-(3'-iodoallyl)-N'-4-(3'',4''-dimethoxyphenethyl)-piperazine [PDF Version]
    [¹²⁵I]E-1
    Liang Shan.
    Created: August 16, 2012; Last Update: September 25, 2012.
  - [¹²⁵I]2-Iodo-N-[(S)-{(S)-1-methylpiperidin-2-yl}(phenyl)methyl]3-trifluoromethyl-benzamide [PDF Version]
    [¹²⁵I]5
    Liang Shan.
    Created: April 10, 2012; Last Update: May 30, 2012.
  - [¹²⁵I]Anti-claudin 4 monoclonal antibody [PDF Version]
    [¹²⁵I]Anti-claudin 4
    The MICAD Research Team.
    Created: June 28, 2007; Last Update: August 2, 2007.
  - [¹²⁵I]Anti-prostate stem cell antigen antibody [PDF Version]
    [¹²⁵I]Anti-PSCA antibody
    The MICAD Research Team.
    Created: June 29, 2007; Last Update: August 2, 2007.
  - [¹²⁵I]-Labeled monoclonal antibody L8A4 against epidermal growth factor receptor variant III (EGFRvIII) [PDF Version]
    [¹²⁵I]SGMIB-L8A4
    Arvind Chopra.
    Created: December 24, 2010; Last Update: February 17, 2011.
  - [¹²⁵I]N-(4-Dipropylaminobutyl)-4-iodobenzamide [PDF Version]
    [¹²⁵I]BZ18
    Liang Shan.
    Created: August 5, 2011; Last Update: August 20, 2011.
  - [¹²⁵I]N-[2-[N-Ethyl-N-[2-(2-fluoropyridin-3-yloxy)ethyl]amino]ethyl]-6-iodoquinoxaline-2-carboxamide dihydrochloride salt [PDF Version]
    [¹²⁵I]56
    Liang Shan.
    Created: August 5, 2011; Last Update: August 20, 2011.
  - ¹²⁵I-Anti-malondialdehyde-modified low-density lipoprotein monoclonal antibody [PDF Version]
    ¹²⁵I-MDA2
    Kam Leung.
    Created: August 15, 2009; Last Update: October 22, 2009.
  - ¹²⁵I-Hydroxylated-single-walled nanotubes [PDF Version]
    ¹²⁵I-SWNTols
    Kam Leung.
    Created: September 26, 2008; Last Update: November 17, 2008.
  - ¹²⁵I-Labeled anti-epidermal growth factor receptor human Fab antibody fragment [PDF Version]
    ¹²⁵I-Fab
    Kam Leung.
    Created: April 6, 2010; Last Update: June 18, 2010.
  - ¹²⁵I-Labeled anti-mucin 1 bispecific antibody bsPAM4 [PDF Version]
    [¹²⁵I]-bsPAM4
    Arvind Chopra.
    Created: June 22, 2011; Last Update: July 26, 2011.
  - ¹²⁵I-Labeled heparin-binding peptides that target heparan sulfate proteoglycans for the in vivo imaging of peripheral amyloidosis [PDF Version]
    [¹²⁵I]-Peptides
    Arvind Chopra.
    Created: November 2, 2011; Last Update: December 1, 2011.
  - ¹²⁵I Labeled-mesenchymal-epithelial transition factor binding peptide [PDF Version]
    [¹²⁵I]-cMBP
    Arvind Chopra.
    Created: July 28, 2009; Last Update: September 10, 2009.
  - ¹²⁵I-Labeled mesenchymal-epithelial transition factor binding peptide-8-aminooctanoic acid [PDF Version]
    [¹²⁵I]-cMBP-AOC
    Arvind Chopra.
    Created: July 30, 2009; Last Update: September 10, 2009.
  - ¹²⁵I-Labeled mesenchymal-epithelial transition factor binding peptide-Gly-Gly-Gly [PDF Version]
    [¹²⁵I]cMBP-GGG
    Arvind Chopra.
    Created: July 30, 2009; Last Update: September 10, 2009.
  - ¹²⁵I-Labeled monoclonal antibody, mAb RM2, targeting the RM2 antigen [PDF Version]
    [¹²⁵I]-mAb RM2
    Arvind Chopra.
    Created: September 12, 2012; Last Update: October 11, 2012.
  - ¹²⁵I-Labeled monoclonal antibody PSA30 [PDF Version]
    ¹²⁵I-PSA30
    Liang Shan.
    Created: November 9, 2012; Last Update: December 5, 2012.
  - ¹²⁵I-Labeled mouse anti-human carbonic anhydrase IX monoclonal antibody [PDF Version]
    ¹²⁵I-MAb
    Liang Shan.
    Created: May 3, 2012; Last Update: May 30, 2012.
  - ¹²⁵I-Labeled murine anti-CD20 antigen monoclonal antibody NuB2 conjugated to one or three octaarginine (maleimide-(6-aminocaproic acid)₂-(D-Arg)₈-(D-Tyr)) peptide chains [PDF Version]
    [¹²⁵I]SIB-NuB2i and [¹²⁵I]SIB-NuB2iii
    Arvind Chopra.
    Created: December 8, 2010; Last Update: December 28, 2010.
  - ¹²⁵I-Labeled single-chain monoclonal antibody, NS4F5, that targets the GlcNS6S-IdoA2S motif of heparan sulfate proteoglycans for the in vivo imaging of peripheral amyloidosis [PDF Version]
    [¹²⁵I]-NS4F5
    Arvind Chopra.
    Created: November 4, 2011; Last Update: December 1, 2011.
  - 125I-Labeled trivalent, bispecific monoclonal antibody construct TF10 that targets mucin-1 and is reactive against a histamine-succinyl-glycine hapten IMP-288 [PDF Version]
    [¹²⁵I]-TP10
    Arvind Chopra.
    Created: June 29, 2011; Last Update: August 25, 2011.
  - ¹²⁵I-Radioiodinated tyrosine-folate and tyrosine-click-folate [PDF Version]
    [¹²⁵I]-2 and [¹²⁵I]-4
    Liang Shan.
    Created: May 20, 2012; Last Update: June 27, 2012.
  - ¹²⁵I-Single-chain antibody B1 targeting a pancreatic β-cell surface antigen [PDF Version]
    ¹²⁵I-SCA B1
    Kam Leung.
    Created: February 2, 2012; Last Update: May 17, 2012.
  - ¹²⁵I-Single-chain antibody B5 targeting a pancreatic β-cell surface antigen [PDF Version]
    ¹²⁵I-SCA B5
    Kam Leung.
    Created: February 2, 2012; Last Update: May 17, 2012.
  - ¹²⁵I-T84.66 scFv-human serum albumin [PDF Version]
    ¹²⁵I-T84.66 scFv-HSA
    Kam Leung.
    Created: July 2, 2008; Last Update: September 2, 2008.
  - ¹²⁵I-Vascular endothelial growth factor-121 [PDF Version]
    ¹²⁵I-VEGF₁₂₁
    Kam Leung.
    Created: June 6, 2007; Last Update: July 6, 2007.
  - 2-(4'-Dimethylaminophenyl)-6-[¹²⁵I]iodobenzothiazole [PDF Version]
    [¹²⁵I]TZDM
    The MICAD Research Team.
    Created: January 8, 2007; Last Update: January 18, 2007.
  - 2-{[4-(4-[¹²⁵I]Iodobenzyl)piperidin-1-yl]methyl}benzimidazol-5-ol [PDF Version]
    [¹²⁵I]8
    Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - 3-(4-Hydroxy-3-[¹²⁵I]iodophenyl)propionate-exendin(9-39) [PDF Version]
    [¹²⁵I]-BH-Exendin(9-39)
    Kam Leung.
    Created: April 6, 2010; Last Update: June 18, 2010.
  - Biotinylated anti-Tn MLS128 monoclonal antibody-¹²⁵I-streptavidin [PDF Version]
    Bt-MLS128-¹²⁵I-SA
    Liang Shan.
    Created: July 21, 2009; Last Update: September 17, 2009.
  - Fluorinated and iodinated (Z)-2-(4-(2-fluoroethoxy)benzylidene)-5-iodobenzofuran-3(2H)-one [PDF Version]
    [¹⁸F/¹²⁵I]3
    Liang Shan.
    Created: November 30, 2011; Last Update: December 28, 2011.
  - N,N-Diethyl-2-(2-(3-[¹²⁵I]iodo-4-methyoxyphenyl)-5,7-dimethyl-pyrazolo(1,5-a)pyrimidin-3-yl)-acetamide [PDF Version]
    [¹²⁵I]-IodoDPA-713
    Kam Leung.
    Created: April 16, 2010; Last Update: June 3, 2010.
  - N-{2-[4-(4-[¹²⁵I]Iodobenzyl)-piperidin-1-ylmethyl]benzoimidazol-5-yl}-methanesulfonamide [PDF Version]
    [¹²⁵I]9
    Arvind Chopra.
    Created: January 31, 2011; Last Update: March 31, 2011.
  - N¹,N¹-diethyl-N⁴-(7-[¹²⁵I]iodoquinolin-4-yl)pentane-1,4-diamine [PDF Version]
    ¹²⁵I IQ
    Liang Shan.
    Created: March 19, 2012; Last Update: May 2, 2012.
  - Radioiodinated (1E,4E)-1-(4-aminophenyl)-5-(4-iodophenyl)penta-1,4-dien-3-one and (1E,4E)-1-(4-iodophenyl)-5-(4-(methylamino)phenyl)penta-1,4-dien-3-one [PDF Version]
    [¹²⁵I]70, [¹²⁵I]71
    Liang Shan.
    Created: December 12, 2011; Last Update: February 7, 2012.
  - Radioiodinated (Z)-2-(4-(2-hydroxyethoxy)benzylidene)-5-iodobenzofuran-3(2H)-one [PDF Version]
    [¹²⁵I]15
    Liang Shan.
    Created: November 30, 2011; Last Update: December 28, 2011.
  - Radioiodinated anti-CD105 MAEND3 monoclonal antibody [PDF Version]
    ¹²⁵I-MAEND3 MAb
    Kenneth T. Cheng.
    Created: April 5, 2006; Last Update: January 9, 2008.
  - Radioiodinated anti–TAG-72 CC49 Fab’ antibody fragment [PDF Version]
    ¹²⁵I-CC49 Fab’
    Kenneth T. Cheng.
    Created: March 10, 2008; Last Update: April 9, 2008.
  - Radioiodinated-anti–TAG-72 covalently linked CC49 divalent single-chain Fv antibody [PDF Version]
    ¹²⁵I-CC49 sc(Fv)₂ Ab
    Kenneth T. Cheng.
    Created: September 25, 2007; Last Update: October 30, 2007.
  - Radiolabeled (hetero)aromatic analogs of N-(2-diethylaminoethyl)-4-iodobenzamide for imaging and therapy of melanoma [PDF Version]
    [¹²⁵I]5a-I
    Liang Shan.
    Created: November 19, 2009; Last Update: December 30, 2009.
- 125I/131I
  - Radioiodinated anti-TAG-72 CC49 tetravalent single-chain Fv antibody [PDF Version]
    ¹²⁵I/¹³¹I-CC49 [sc(Fv)₂]₂ Ab
    Kenneth T. Cheng.
    Created: July 23, 2007; Last Update: January 22, 2008.
  - Radioiodinated anti-TAG-72 humanized C_H2 domain-deleted antibody [PDF Version]
    Radioiodinated HuCC49ΔC_H2 Ab
    Kenneth T. Cheng.
    Created: August 30, 2007; Last Update: November 14, 2007.
  - Radioiodinated anti–TAG-72 non-covalently linked CC49 divalent single-chain Fv antibody [PDF Version]
    ¹²⁵I/¹³¹I-CC49 (scFv)₂ Ab
    Kenneth T. Cheng.
    Created: December 5, 2007; Last Update: January 7, 2008.
  - Radioiodinated humanized monoclonal antibody A33 [PDF Version]
    Radioiodinated-huA33 mAb
    Arvind Chopra.
    Created: September 16, 2007; Last Update: October 22, 2007.
  - Radioiodinated MLS128 anti-Tn murine monoclonal antibody [PDF Version]
    Radioiodinated-MLS128
    Liang Shan.
    Created: July 21, 2009; Last Update: August 25, 2009.
- 125mTe
  - Cd^125mTe/ZnS Nanoparticles coupled with anti-thrombomodulin monoclonal antibody 201B [PDF Version]
    Cd^125mTe/ZnS-201B
    Kam Leung.
    Created: September 26, 2009; Last Update: December 24, 2009.
- 131I
  - [¹³¹I]N-(6-amino-2,2,4-trimethylhexyl)-2-[(5-iodo(3-pyridyl))carbonylamino]-3-(2-napthyl)propanamide [PDF Version]
    [¹³¹I]IPC-β-AL3
    Arvind Chopra.
    Created: June 22, 2009; Last Update: August 4, 2009.
  - ¹³¹I-Chlorotoxin [PDF Version]
    ¹³¹I-TM-601
    The MICAD Research Team.
    Created: July 17, 2007; Last Update: August 8, 2007.
  - ¹³¹I-Human recombinant anti-ED-B fibronectin antibody small immunoprotein [PDF Version]
    ¹³¹I-L19-SIP
    Kam Leung.
    Created: April 17, 2007; Last Update: July 6, 2007.
  - ¹³¹I-Labeled [Z]-2-[4-(1,2-diphenyl-1-di-butenyl)-phenoxy]-N,N-dimethylethanamine [PDF Version]
    ¹³¹I-TAM
    Liang Shan.
    Created: July 6, 2009; Last Update: August 18, 2009.
  - ¹³¹I-Labeled anti-α folate receptor human antibody fragment AFRA-DMF5.3 dimer [PDF Version]
    [¹³¹I]-AFRA-DFM5.3
    Arvind Chopra.
    Created: December 9, 2011; Last Update: December 26, 2011.
  - ¹³¹I-Labeled recombinant anti-glycoprotein A33 antibody single chain variable fragment fused to cytosine deaminase [PDF Version]
    [¹³¹I]A33scFv::CDy
    Arvind Chopra.
    Created: July 8, 2009; Last Update: August 12, 2009.
  - ¹³¹I-NP-4 anti-CEA monoclonal antibody [PDF Version]
    ¹³¹I-NP-4 MAb
    Kenneth T. Cheng.
    Created: December 27, 2005; Last Update: March 11, 2008.
  - ¹³¹I-Tositumomab [PDF Version]
    ¹³¹I-B1 MAb
    Kenneth T. Cheng.
    Created: October 19, 2005; Last Update: June 2, 2008.
  - 3'-(E)-(2-[^123/131I]Iodovinyl)uridine [PDF Version]
    [^123/131I]IV-14
    Kam Leung.
    Created: March 17, 2010; Last Update: April 22, 2010.
  - N-(5-Fluoro-2-phenoxyphenyl)-N-(2-[¹³¹I]iodo-5-methoxybenzyl)acetamide [PDF Version]
    [¹³¹I]PBR3a
    Kam Leung.
    Created: August 6, 2007; Last Update: September 12, 2007.
  - N(ε)-(3-[¹³¹I]Iodobenzoyl)-Lys⁵-N(α)-maleimido-Gly¹-GEEEK-anti-HER2 nanobody 5F7GGC [PDF Version]
    [¹³¹I]IB-Mal-D-GEEEK-Nb
    Kam Leung.
    Created: January 15, 2013; Last Update: March 28, 2013.
  - R-2-[¹³¹I]Iodophenyl-(1-(1-methylpiperidin-2-ylmethyl)-1H-indol-3-yl)methanone [PDF Version]
    R-[¹³¹I]AM2233
    Kam Leung.
    Created: December 12, 2006; Last Update: February 12, 2008.
  - Radioiodinated anti-DNA-histone 1 complex chimeric tumor necrosis therapy (TNT) monoclonal antibody 1 [PDF Version]
    [^125/131I]-chTNT-1/B
    Arvind Chopra.
    Created: September 17, 2011; Last Update: December 1, 2011.
- 131I, 123I, 125I
  - Radioiodinated anti-CEA monoclonal antibody NP-4 F(ab´)₂ fragment [PDF Version]
    ¹²³I/¹³¹I/¹²⁵I-NP-4 F(ab´)₂
    Kenneth T. Cheng.
    Created: March 23, 2006; Last Update: April 10, 2008.
- 131I, 125I
  - Radioiodinated anti–TAG-72 CC49 (Fab’)₂ antibody fragment [PDF Version]
    ¹³¹I/¹²⁵I-CC49 (Fab’)₂
    Kenneth T. Cheng.
    Created: November 5, 2007; Last Update: January 9, 2008.
- 170Tm
  - [¹⁷⁰Tm]-Labeled ethylenediamine tetramethylene phosphonic acid [PDF Version]
    [¹⁷⁰Tm]-EDTMP
    Arvind Chopra.
    Created: April 27, 2011; Last Update: May 26, 2011.
- 177Lu
  - [¹⁷⁷Lu]-Labeled (S-2-(4-isothiocyanatobenzyl)-1,4,7,10-tetraazacyclododecane-tetraacetic acid (C-DOTA) conjugated monoclonal antibody L8A4 against epidermal growth factor receptor variant III (EGFRvIII) [PDF Version]
    [¹⁷⁷Lu]C-DOTA-L8A4
    Arvind Chopra.
    Created: December 24, 2010; Last Update: February 17, 2011.
  - [¹⁷⁷Lu]-Labeled [(R)-2-amino-3-(4-isothiocyanatophenyl)propyl]-trans-(S,S)-cyclohexane-1,2-diamine-pentaacetic acid (CHX-A″-DTPA) conjugated monoclonal antibody L8A4 against epidermal growth factor receptor variant III (EGFRvIII) [PDF Version]
    [¹⁷⁷Lu]CHX-A''-DTPA-L8A4
    Arvind Chopra.
    Created: December 24, 2010; Last Update: February 17, 2011.
  - [¹⁷⁷Lu]-Labeled 2-(4-isothiocyanatobenzyl)-6-methyldiethylene-triaminepentaacetic acid (1B4M-DTPA) conjugated monoclonal antibody L8A4 against epidermal growth factor receptor variant III (EGFRvIII) [PDF Version]
    [¹⁷⁷Lu]1B4M-DTPA-L8A4
    Arvind Chopra.
    Created: December 24, 2010; Last Update: February 17, 2011.
  - [¹⁷⁷Lu]-Labeled α-(5-isothiocyanato-2-methoxyphenyl)-1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid (MeO-DOTA) conjugated monoclonal antibody L8A4 against epidermal growth factor receptor variant III (EGFRvIII) [PDF Version]
    [¹⁷⁷Lu]MeO-DOTA-L8A4
    Arvind Chopra.
    Created: December 24, 2010; Last Update: February 17, 2011.
  - ¹⁷⁷Lu-1,4,7,10-Tetraazacyclododecane-1,4,7-triacetic acid-human serum albumin-Ac-Cys-Z_EGFR:1907 [PDF Version]
    ¹⁷⁷Lu-DO3A-HSA-Z_EGFR:1907
    Kam Leung.
    Created: June 25, 2012; Last Update: November 15, 2012.
  - ¹⁷⁷Lu-Benzyl-diethylenetriamine pentaacetic acid-anti-carbonic anhydrase IX small immunoprotein A3 [PDF Version]
    ¹⁷⁷Lu-Bn-DTPA-SIP-A3
    Kam Leung.
    Created: December 2, 2009; Last Update: January 12, 2010.
  - ¹⁷⁷Lu-CHX-A''-DTPA-ABD-Affibody (Z_HER2:342)₂ [PDF Version]
    ¹⁷⁷Lu-ABD-(Z_HER2:342)₂
    Huiming Zhang.
    Created: July 25, 2008; Last Update: August 27, 2008.
  - ¹⁷⁷Lu-DOTA-Gly-4-aminobenzoyl-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    [¹⁷⁷Lu]-AMBA
    Huiming Zhang.
    Created: October 1, 2008; Last Update: November 17, 2008.
  - ¹⁷⁷Lu-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-Tyr-cyclo(DAB-Arg-cyclo(Cys-Phe-d-Trp-Lys-Thr-Cys)) [PDF Version]
    ¹⁷⁷Lu-AM3
    Liang Shan.
    Created: December 10, 2010; Last Update: January 18, 2011.
  - ¹⁷⁷Lu-Labeled aglycosylated anti-L1-CAM monoclonal antibody chCE7 [PDF Version]
    [¹⁷⁷Lu]-chCE7agl
    Arvind Chopra.
    Created: June 26, 2012; Last Update: July 26, 2012.
  - ¹⁷⁷Lu-Labeled DOTA-conjugated AE105 peptide (Asp-Cha-Phe-(d)Ser-(d)Arg-Tyr-Leu-Trp-Ser-CONH₂) [PDF Version]
    [¹⁷⁷Lu]-DOTA-AE105
    Arvind Chopra.
    Created: September 13, 2012; Last Update: November 8, 2012.
  - ¹⁷⁷Lu-Labeled ethylenediamine tetramethylene phosphonic acid [PDF Version]
    [¹⁷⁷Lu]-EDTMP
    Arvind Chopra.
    Created: April 28, 2011; Last Update: May 26, 2011.
  - ¹⁷⁷Lu-Labeled h-R3 (nimotuzumab), a humanized monoclonal antibody targeting the external domain of the epidermal growth factor receptor [PDF Version]
    [¹⁷⁷Lu]-h-R3
    Arvind Chopra.
    Created: January 4, 2012; Last Update: February 2, 2012.
  - ¹⁷⁷Lu-Labeled humanized monoclonal antibody against human epidermal growth factor receptor 2 [PDF Version]
    [¹⁷⁷Lu]Pertuzumab
    Arvind Chopra.
    Created: November 17, 2008; Last Update: December 17, 2008.
  - ¹⁷⁷Lu-Labeled methylene diphosphonate [PDF Version]
    [¹⁷⁷Lu]-MDP
    Arvind Chopra.
    Created: May 24, 2011; Last Update: June 30, 2011.
  - ¹⁷⁷Lu-Labeled sodium pyrophosphate [PDF Version]
    ¹⁷⁷Lu-PYP
    Liang Shan.
    Created: November 27, 2012; Last Update: December 19, 2012.
- 186Re
  - ¹⁸⁶Re-Labeled [N-[2[[3-(3,3-diphosphonopropylcarbamoyl)propyl]-2-thioethylamino]acetyl]-2-aminoethylenethiolate] oxorhenium (V) [PDF Version]
    [¹⁸⁶Re]MAMA-BP
    Arvind Chopra.
    Created: November 6, 2009; Last Update: June 3, 2010.
  - ¹⁸⁶Re-Labeled [N-[2-[[4-[(4-hydroxy-4,4-diphosphonobutyl)amino]-4-oxobutyl]-2-thioethylamino]acetyl]-2-aminoethanethiolate] oxorhenium (V) [PDF Version]
    [¹⁸⁶Re]MAMA-HBP
    Arvind Chopra.
    Created: November 6, 2009; Last Update: June 3, 2010.
- 188Re
  - ¹⁸⁸Re-Labeled humanized monoclonal anti-epidermal growth factor receptor antibody [PDF Version]
    ¹⁸⁸Re-Nimotuzumab
    Arvind Chopra.
    Created: August 4, 2008; Last Update: September 2, 2008.
- 211At
  - ²¹³Bi/²¹¹At-Labeled MX35, an anti–sodium-dependent phosphate transport protein 2b (NaPi2b) murine monoclonal antibody [PDF Version]
    [²¹³Bi]MX35 and [²¹¹At]MX35
    Arvind Chopra.
    Created: February 27, 2012; Last Update: May 31, 2012.
- 67Ga
  - ⁶⁷Ga-1,4,7,10-Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid-Gly-Glu-c[Lys-Nlc-Glu-His-d-Phe-Arg-Trp-Gly-Arg-Pro-Val-Asp] [PDF Version]
    ⁶⁷Ga-DOTA-GlyGlu-CycMSH
    Kam Leung.
    Created: April 28, 2010; Last Update: June 3, 2010.
  - ⁶⁷Ga labeled cyclic diethylenetriamine pentaacetic acid Insulin [PDF Version]
    [⁶⁷Ga]-insulin
    Arvind Chopra.
    Created: May 22, 2008; Last Update: July 14, 2008.
  - ⁶⁷Ga-Tetraazacyclododecane-N,N',N'',N'''-tetraacetic acid-3-{2-[2-(3-amino-propoxy)-ethoxy]-ethoxy}-propylamine-γ-folate [PDF Version]
    ⁶⁷Ga-P1254
    Kam Leung.
    Created: February 14, 2011; Last Update: May 26, 2011.
- 99mTc
  - [2[[2-[[[3-(4-chlorophenyl)-8-methyl-8-azabicyclo[3,2,1]-oct-2-yl]-methyl](2-mercaptoethyl)amino]ethyl]amino]ethanethiolato(3-)-N2,N2’,S2,S2]oxo-[1R-exo-exo)])- [^99mTc]-technetium [PDF Version]
    ^99mTc-TRODAT-1
    Arvind Chopra.
    Created: April 24, 2007; Last Update: December 20, 2007.
  - [^99mTc/⁹⁰Y]-1,4,7,10 Tetraazacyclododecane-N,N’,N’’,N’’’-tetraacetic acid phenylalanine derivative conjugated to anti-epidermal growth factor receptor antibody ior egf/r3 [PDF Version]
    [^99mTc/⁹⁰Y]DOTA-Ph-Al-ior egf/r3
    Puja Panwar, Normando Iznaga-Escobar, Pushpa Mishra, Vibha Srivastava, Rakesh Sharma, Ramesh Chandra, Anil Mishra, and Arvind Chopra.
    Created: August 27, 2009; Last Update: October 15, 2009.
  - [^99mTc(CO)₃]⁺-Labeled anti-epidermal growth factor receptor (HER2) affibody Z_HER2:342 with a hexa-histidine tag (H₆) on the C-terminal [PDF Version]
    [^99mTc(CO)₃]⁺-Z_HER2:342-H₆
    Arvind Chopra.
    Created: December 20, 2010; Last Update: January 20, 2011.
  - [^99mTc(CO)₃]⁺-Labeled anti-epidermal growth factor receptor (HER2) affibody Z_HER2:342 with a hexa-histidine tag (H₆) on the N-terminal [PDF Version]
    [^99mTc(CO)₃]⁺-H₆-Z_HER2:342
    Arvind Chopra.
    Created: December 16, 2010; Last Update: January 20, 2011.
  - [^99mTc(CO)₃]⁺-Labeled anti-epidermal growth factor receptor (HER2) affibody Z_HER2:342 with a tri-(histidine-glutamate) peptide tag (HE)₃ on the N-terminal [PDF Version]
    [^99mTc(CO)₃]⁺-(HE)₃-Z_HER2:342
    Arvind Chopra.
    Created: December 21, 2010; Last Update: January 20, 2011.
  - [^99mTc(N)(NS-Cys-Gly-CCK-8)(PNP3)]⁺ [PDF Version]
    ^99mTc(N)(PNP3)-CCK-8
    The MICAD Research Team.
    Created: April 30, 2007; Last Update: May 30, 2007.
  - [^99mTc](CO)₃N-(pyridin-2-yl-methyl)-N[2-(4-sulfamoylphenyl)-ethyl]aminoethyl acetate [PDF Version]
    [^99mTc]5
    Arvind Chopra.
    Created: August 25, 2010; Last Update: October 28, 2010.
  - [^99mTc]1,4,7,10-tetraazacyclododecane-N, N’, N’’, N’’’-tetraacetic acid-Phe-Lys-histamine-succinyl-Gly-D-Tyr-Lys- histamine-succinyl-Gly-thiosemicarbazonyl-glyoxyl-cysteine [PDF Version]
    [^99mTc]IMP-245
    Arvind Chopra.
    Created: March 13, 2008; Last Update: May 22, 2008.
  - [^99mTc]-1,4,7,10-Tetraazacyclododecane tetramethylenephosphonic acid [PDF Version]
    Anupama Datta, Puja Panwar, Krishna Chuttani, Anil Kumar Mishra, and Arvind Chopra.
    Created: March 31, 2009; Last Update: June 9, 2009.
  - [^99mTc]4-Dithiocarbamato-N-benzylpiperidine [PDF Version]
    [[^99mTc]N(PNP)Pip-DTC]+
    Drishty Satpati, Ketaki Bapat, Haladhar Deb Sarma, Kanchan Kothari, Meera Venkatesh, Sharmila Banerjee, and Arvind Chopra.
    Created: April 3, 2008; Last Update: May 14, 2008.
  - [^99mTc]-Acetyl-arg-arg-arg-arg-arg-cys-gly-cys-gly-gly-pro-leu-tyr-arg-arg-ile-ile-arg-arg-leu-leu-glu-ser-dermatan sulfate [PDF Version]
    ^99mTc-P1827DS
    Arvind Chopra.
    Created: November 19, 2007; Last Update: December 19, 2007.
  - [^99mTc]Anti-CD3 monoclonal antibody [PDF Version]
    [^99mTc]Anti-CD3 mAb
    Arvind Chopra.
    Created: January 28, 2008; Last Update: March 10, 2008.
  - [^99mTc]Cyclo(L-homocysteinyl-N-methyl-L-phenylalanyl-L-tyrosyl-D-tryptophyl-L-lysyl-L-valyl), (1‡1´)-sulfide with 3-[(mercaptoacetyl)amino]-L-alanyl-L-lysyl-L-cysteinyl-L-lysinamide [PDF Version]
    [^99mTc]Depreotide
    Arvind Chopra.
    Created: March 27, 2008; Last Update: May 27, 2008.
  - [^99mTc]-diethylenetriaminepentaacetic acid-galactosyl human serum albumin [PDF Version]
    ^99mTc-GSA
    Arvind Chopra.
    Created: April 24, 2007; Last Update: June 12, 2007.
  - [^99mTc]Epidermal growth factor receptor–specific nanobody [PDF Version]
    [^99mTc]EGFR nanobody
    Arvind Chopra.
    Created: April 22, 2008; Last Update: May 13, 2008.
  - [^99mTc]Human telomerase reverse-transcriptase antisense mRNA oligonucleotide [PDF Version]
    [^99mTc]MAG3-ASON
    Arvind Chopra.
    Created: May 7, 2008; Last Update: May 27, 2008.
  - [^99mTc]-Mercaptoacetyldiglycyl-1,5-diaminopentylene hypericincarboxamide [PDF Version]
    [^99mTc]-Hypericin
    Arvind Chopra.
    Created: February 26, 2008; Last Update: March 25, 2008.
  - [^99mTc]-Pentavalent dimercaptosuccinic acid [PDF Version]
    [^99mTc]-(V)DMSA
    Arvind Chopra.
    Created: June 11, 2010; Last Update: July 29, 2010.
  - [^99mTc]Vasoactive intestinal peptide-aminobutyric acid-Gly-Gly-(D)-Ala-Gly [PDF Version]
    [^99mTc]TP3654
    Arvind Chopra.
    Created: March 7, 2008; Last Update: April 17, 2008.
  - [^99mTc-Gly-Gly-Cys]-Ornithine-ornithine-ornithine-cyclo(Arg-Gly-Asp-d-Phe-Lys) [PDF Version]
    [^99mTc-GGC]-(Orn)₃-c(RGDfK)
    Kam Leung.
    Created: February 16, 2013; Last Update: April 18, 2013.
  - [^99mTc-N₄^0-1-bzlg⁰,D-Phe⁶,Leu-NHEt¹³,des-Met¹⁴]Bombesin(6–14) [PDF Version]
    [^99mTc]Demobesin 1
    Liang Shan.
    Created: August 30, 2009; Last Update: October 28, 2009.
  - ^99mTc/¹¹¹In-Labeled DTPA-succinyl polylysine [PDF Version]
    [^99mTc/¹¹¹In]-DSPL
    Arvind Chopra.
    Created: October 16, 2012; Last Update: November 21, 2012.
  - ^99mTc/¹⁸⁸Re-Labeled dipicolylamine-alendronate [PDF Version]
    [^99mTc/¹⁸⁸Re]DPA-alendronate
    Arvind Chopra.
    Created: April 21, 2010; Last Update: May 24, 2010.
  - ^99mTc-(3Z)-4-{4-[2-(Dimethylamino)ethoxy]phenyl}-3,4-diphenylbut-3-en-1-ylN,N-bis[2-(2,6-dioxomorpholin-4-yl)ethyl]glycinate [PDF Version]
    ^99mTc-DTPA-TOR
    Kam Leung.
    Created: May 25, 2010; Last Update: July 7, 2010.
  - ^99mTc(CO)₃-((S-Pyridin-2-ylmethyl)-Cys)-Nle-Asp-His-d-Phe-Arg-Trp-Gly-Lys-NH₂ [PDF Version]
    Kam Leung.
    Created: January 28, 2013; Last Update: April 18, 2013.
  - ^99mTc(CO)₃-Anti-carcinoembryonic antigen (CEA) humanized CEA5 graft nanobody [PDF Version]
    ^99mTc-Humanized CEA5 graft
    Kam Leung.
    Created: April 11, 2012; Last Update: July 26, 2012.
  - ^99mTc(CO)₃-Anti-epidermal growth factor receptor nanobody 8B6 [PDF Version]
    ^99mTc(CO)₃-8B6
    Kam Leung.
    Created: April 11, 2012; Last Update: July 12, 2012.
  - ^99mTc(CO)₃-Anti-vascular cell adhesion molecule-1 nanobody cAbVCAM1-5 [PDF Version]
    ^99mTc-cAbVCAM1-5
    Kam Leung.
    Created: April 5, 2012; Last Update: July 26, 2012.
  - ^99mTc(CO)₃-Bipyridine-cyclo-(Arg-Gly-Asp-D-Tyr-Lys) [PDF Version]
    ^99mTc(CO)₃-BPy-c(RGDyK)
    Kam Leung.
    Created: June 14, 2007; Last Update: August 14, 2007.
  - ^99mTc(CO)₃-Pyrazolyl-cyclo(Arg-Gly-Asp-D-Tyr-Lys) [PDF Version]
    ^99mTc(CO)₃-PZ-c(RGDyK)
    Kam Leung.
    Created: July 9, 2007; Last Update: August 27, 2007.
  - ^99mTc-(Hydrazinonicotinic acid-duramycin)(tricine)(TPPTS) [PDF Version]
    ^99mTc-Duramycin
    Kam Leung.
    Created: October 25, 2008; Last Update: January 2, 2009.
  - ^99mTc-(Hydrazinonicotinic acid-β-Ala-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂)(tricine)(TPPTS) [PDF Version]
    ^99mTc-(HYNIC-ABN)(tricine)(TPPTS)
    Kam Leung.
    Created: October 25, 2008; Last Update: December 12, 2008.
  - ^99mTc-(N^αHis)Ac-(Arg-N-CH₃)-Arg-Pro-(dimethyl-Tyr)-(tertary-Leu)-Leu [PDF Version]
    ^99mTc-NT-XIX
    Kam Leung.
    Created: August 5, 2009; Last Update: September 18, 2009.
  - ^99mTc-(RR,SS)-4,8-diaza-3,6,6,9-tetramethylundecane-2,10-dione bisoxime [PDF Version]
    ^99mTc-HMPAO
    Arvind Chopra.
    Created: May 14, 2007; Last Update: June 5, 2009.
  - ^99mTc^(v)O-Gly-Gly-Cys-Orn-Orn-Orn-Bombesin[2-14] [PDF Version]
    ^99mTc-N₃S-X-BN[2-14]
    Liang Shan.
    Created: August 19, 2009; Last Update: September 23, 2009.
  - ^99mTc-[Ac-CCEHdFRWCKPV-NH₂] [PDF Version]
    ^99mTc-CCMSH
    Kenneth T Cheng.
    Created: April 7, 2008; Last Update: April 30, 2008.
  - ^99mTc-[Cys^3,4,10,d-Phe⁷,Arg¹¹]α-MSH_3-13 [PDF Version]
    ^99mTc-(Arg¹¹)CCMSH
    Kenneth T Cheng and Thomas P Quinn.
    Created: January 26, 2007; Last Update: January 22, 2008.
  - ^99mTc-1,4,7-Tris(carboxymethyl)-10-(4-aminoethyl)-1,4,7,10-tetraazacyclododecane-Folate [PDF Version]
    ^99mTc-DO3A-EA-Folate
    Kam Leung.
    Created: November 22, 2012; Last Update: January 31, 2013.
  - ^99mTc-2-[Bis-(2-mercaptoethyl)]aminoethanethiol-4-isocyano-N-[2-(2-methyl-5-nitro-1H-imidazol-1-yl)ethyl]butanamide [PDF Version]
    ^99mTc-NS₃M1
    Liang Shan.
    Created: May 16, 2012; Last Update: July 10, 2012.
  - ^99mTc-2-Methoxyisobutylisonitrile [PDF Version]
    ^99mTc-MIBI
    Kam Leung.
    Created: October 5, 2004; Last Update: December 8, 2004.
  - ^99mTc-Acetyl-Asn-Gln-Glu-Gln-Val-Ser-Pro-3-iodo-Tyr-Thr-Leu-Leu-Lys-Gly-NC100194 [PDF Version]
    ^99mTc-NC100668
    Kam Leung.
    Created: May 7, 2007; Last Update: February 11, 2008.
  - ^99mTc-Ac-Lys(DTPA)-Tyr-Lys(DTPA)-Lys(thiosemicarbazonyl-glyoxyl-cysteinyl-)-NH2 (IMP-192) [PDF Version]
    [^99mTc]-IMP-192
    Arvind Chopra.
    Created: June 27, 2011; Last Update: July 26, 2011.
  - ^99mTc-Affibody Z_HER2:2395-Cys [PDF Version]
    ^99mTc-Z₂₃₉₅-C
    Kam Leung.
    Created: September 16, 2009; Last Update: November 19, 2009.
  - ^99mTc-Anti-CD105 E9 monoclonal antibody [PDF Version]
    ^99mTc-CD105 E9 MAb
    Kenneth T. Cheng.
    Created: July 14, 2007; Last Update: December 10, 2007.
  - ^99mTc-Anti-ED-B fibronectin L19-(Gy)₃-Cys-Ala scFv antibody fragment [PDF Version]
    ^99mTc-AP39
    Kenneth T. Cheng.
    Created: February 6, 2007; Last Update: January 14, 2008.
  - ^99mTc-Anti-ED-B fibronectin single-chain antibody fragment L19-Hi20 [PDF Version]
    ^99mTc-L19-Hi20
    Kenneth T. Cheng.
    Created: February 26, 2007; Last Update: January 15, 2008.
  - ^99mTc-Anti-ED-B fibronectin single-chain antibody fragment L19-His [PDF Version]
    ^99mTc-L19-His
    Kenneth T. Cheng.
    Created: February 12, 2007; Last Update: January 16, 2008.
  - ^99mTc- anti-EGFR monoclonal antibody h-R3 [PDF Version]
    ^99mTc-hR3
    The MICAD Research Team.
    Created: May 22, 2007; Last Update: June 25, 2007.
  - ^99mTc-Arcitumomab [PDF Version]
    ^99mTc-IMMU-4
    Kenneth T. Cheng.
    Created: December 11, 2005; Last Update: March 17, 2008.
  - ^99mTc-Bis-amino-bis-thiol-conjugated 6-(3-bromopropoxy)-2-(4-(dimethylamino)phenyl)-4H-chromen-4-one and (Z)-5-(3-bromopropoxy)-2-(4-(dimethylamino)benzylidene)benzofuran-3(2H)-one [PDF Version]
    [^99mTc]BAT-FL, [^99mTc]BAT-AR
    Liang Shan.
    Created: November 30, 2011; Last Update: December 28, 2011.
  - ^99mTc-CCND1-PNA-IGF1 Chimeras [PDF Version]
    ^99mTc-WT4185
    Kenneth T Cheng, Eric Wickstrom, Xiaobing Tian, Mohan R Aruva, Wenyi Qin, Weizhu Zhu, Kevin T Duffy, Edward R Sauter, and Mathew L Thakur.
    Created: November 1, 2006; Last Update: January 16, 2008.
  - ^99mTc-Cys-Gly-Gly-Affibody Z_HER2:342 [PDF Version]
    ^99mTc-CGG-Z_HER2:342
    Kam Leung.
    Created: February 16, 2008; Last Update: April 7, 2008.
  - ^99mTc-Diamine dioxime-Lys-Cys-Arg-Gly-Asp-Cyc-Phe-Cys-polyethylene glycol [PDF Version]
    ^99mTc-NC100692
    Kam Leung.
    Created: April 9, 2010; Last Update: May 20, 2010.
  - ^99mTc-Diethylenetriaminepentaacetate-deoxyglucose [PDF Version]
    ^99mTc-DTPA-DG
    Kenneth T. Cheng.
    Created: March 6, 2007; Last Update: March 12, 2008.
  - ^99mTc-Diethylenetriamine pentaacetic acid–lactosyl human serum albumin [PDF Version]
    ^99mTc-LACTAL
    Liang Shan.
    Created: August 23, 2010; Last Update: October 1, 2010.
  - ^99mTc-Diethylenetriaminepentaacetic acid-mannosyl-dextran [PDF Version]
    ^99mTc-DTPA-Mannosyl-dextran
    Kenneth T. Cheng, David R. Vera, Anne M. Wallace, Carl K Hoh, Jeanette Mendez, and Kam Leung.
    Created: October 23, 2007; Last Update: March 2, 2011.
  - ^99mTc-Diethylenetriamine pentaacetic acid superparamagnetic iron oxide nanoparticles conjugated with lactobionic acid [PDF Version]
    ^99mTc-DTPA-SPION-LBA
    Kam Leung.
    Created: April 28, 2010; Last Update: May 20, 2010.
  - ^99mTc-Ethylenediaminediacetic acid/hydrazinonicotinamide-[dGlu¹]minigastrin [PDF Version]
    ^99mTc-EDDA/HYNIC-MG0
    Kenneth T. Cheng.
    Created: May 2, 2007; Last Update: January 28, 2008.
  - ^99mTc-Ethylenediaminediacetic acid/hydrazinonicotinic acid-[dGlu¹, desGlu^2–6]minigastrin [PDF Version]
    ^99mTc-EDDA/HYNIC-MG11
    The MICAD Research Team.
    Created: May 4, 2007; Last Update: June 7, 2007.
  - ^99mTc-Ethylenediaminediacetic acid/hydrazinonicotinic acid-cyclo(Arg-Gly-Asp-D-Try-Lys) [PDF Version]
    ^99mTc-EDDA/HYNIC-c(RGDyK)
    Kam Leung.
    Created: July 15, 2007; Last Update: August 27, 2007.
  - ^99mTc-ethylenediamine N,N’-diacetic acid/hydrazinonicotinamide-Tyr³-octreotide [PDF Version]
    ^99mTc-HYNIC-TOC
    Arvind Chopra.
    Created: October 12, 2007; Last Update: November 7, 2007.
  - ^99mTc-Ethylenedicysteine-C225 [PDF Version]
    ^99mTc-EC-C225
    Kam Leung.
    Created: April 22, 2005; Last Update: December 29, 2011.
  - ^99mTc-Ethylenedicysteine-deoxyglucose [PDF Version]
    ^99mTc-EC-DG
    Kam Leung.
    Created: October 17, 2009; Last Update: February 16, 2010.
  - ^99mTc-Ethylenedicysteine-endostatin [PDF Version]
    ^99mTc-EC-endostatin
    Kam Leung.
    Created: March 3, 2005; Last Update: December 14, 2011.
  - ^99mTc-Ethylenedicysteine-folate [PDF Version]
    ^99mTc-EC-folate
    Kam Leung.
    Created: April 18, 2005; Last Update: January 9, 2011.
  - ^99mTc-Ethylenedicysteine-guanine [PDF Version]
    ^99mTc-EC-Guan
    The MICAD Research Team.
    Created: August 17, 2007; Last Update: September 19, 2007.
  - ^99mTc-Ethylenenediamine-N,N'-diacetic acid/hydrazinonicotinamide[Lys³]-bombesin [PDF Version]
    ^99mTc-EDDA/HYNIC-[Lys³]-BN
    Kenneth T. Cheng, Guillermina Ferro-Flores, and Consuelo Arteaga de Murphy.
    Created: August 15, 2007; Last Update: September 19, 2007.
  - ^99mTc-Fucoidan, a polysaccharidic ligand of P-selectin [PDF Version]
    ^99mTc-Fucoidan
    Kam Leung.
    Created: January 18, 2012; Last Update: April 12, 2012.
  - ^99mTc-Galactosyl-methylated chitosan [PDF Version]
    ^99mTc-GMC
    Kam Leung.
    Created: September 15, 2009; Last Update: December 2, 2009.
  - ^99mTc-Glucosamine-multiwall carbon nanotubes [PDF Version]
    ^99mTc-MWNT-G
    Kenneth T. Cheng, Jinxue. Guo, and Xiao Zhang.
    Created: October 2, 2007; Last Update: November 5, 2007.
  - ^99mTc-Glucosamino-Asp-cyclo(Arg-Gly-Asp-D-Phe-Lys) [PDF Version]
    Glucosamino ^99mTc-D-c(RGDfK)
    Kam Leung.
    Created: August 15, 2007; Last Update: September 25, 2007.
  - ^99mTc-glutamate peptide 3-aminoethyl estradiol [PDF Version]
    ^99mTc-GAP-EDL
    Arvind Chopra.
    Created: August 27, 2007; Last Update: September 24, 2007.
  - ^99mTc-Gly-Gly-Cys-(Arg)₃-bombesin(2-14)-NH₂ [PDF Version]
    ^99mTc-BN-A
    Liang Shan.
    Created: December 6, 2012; Last Update: January 29, 2013.
  - ^99mTc-Hexamethylpropyleneamine oxime-blue-biotin-liposomes [PDF Version]
    ^99mTc-HMPAO-BBL
    Huiming Zhang.
    Created: March 11, 2008; Last Update: April 22, 2008.
  - ^99mTc-Hexamethylpropyleneamine oxime pH-sensitive liposomes [PDF Version]
    ^99mTc-SpHL
    Vildete Carmo, Mônica De Oliveira, Valbert Cardoso, and Arvind Chopra.
    Created: July 2, 2008; Last Update: August 7, 2008.
  - ^99mTc-Human β-defensin-3 [PDF Version]
    ^99mTc-HBD-3
    Kam Leung.
    Created: August 25, 2009; Last Update: November 19, 2009.
  - ^99mTc-Hydrazinonicotinamide/tricine-eighteen-nucleotide RIα mRNA antisense small interfering oligoribonucleotides [PDF Version]
    ^99mTc-HYNIC/tricine-18-nt-RIα-mRNA-AS siRNAs
    Kenneth T. Cheng.
    Created: September 21, 2007; Last Update: October 23, 2007.
  - ^99mTc-Hydrazinonicotinamide-aminohexanoic acid-Lys⁴⁰-exendin-4 [PDF Version]
    [Lys⁴⁰(Ahx-HYNIC-^99mTc)NH₂]-exendin-4
    Kam Leung.
    Created: January 20, 2012; Last Update: April 26, 2012.
  - ^99mTc-Hydrazinonicotinamide-annexin V [PDF Version]
    ^99mTc-HYNIC-annexin V
    Kam Leung.
    Created: February 28, 2006; Last Update: April 6, 2008.
  - ^99mTc-Hydrazinonicotinamide-anti-TAG-72 CC49 divalent single-chain Fv monoclonal antibody [PDF Version]
    ^99mTc-HYNIC-CC49 sc(Fv)₂ MAb
    Kenneth T. Cheng.
    Created: June 19, 2007; Last Update: January 28, 2008.
  - ^99mTc-Hydrazinonicotinamide-anti-TAG-72 CC49 tetravalent single-chain Fv monoclonal antibody [PDF Version]
    ^99mTc-HYNIC-CC49 [sc(Fv)₂]₂ MAb
    Kenneth T. Cheng.
    Created: June 26, 2007; Last Update: December 28, 2007.
  - ^99mTc-Hydrazinonicotinamide-chitosan-anti-vascular endothelial growth factor receptor 2 monoclonal antibody DC101 [PDF Version]
    ^99mTc-HYNIC-chitosan-DC101
    Kam Leung.
    Created: September 15, 2009; Last Update: December 24, 2009.
  - ^99mTc-Hydrazinonicotinamide-epidermal growth factor [PDF Version]
    ^99mTc-HYNIC-EGF
    Kam Leung.
    Created: June 3, 2005; Last Update: January 11, 2012.
  - ^99mTc-Hydrazinonicotinamide-galactosyl-chitosan [PDF Version]
    ^99mTc-HGC
    Kam Leung.
    Created: September 15, 2009; Last Update: December 2, 2009.
  - ^99mTc-Hydrazinonicotinamide-interleukin-8 [PDF Version]
    ^99mTc-HYNIC-IL-8
    Kam Leung.
    Created: March 9, 2007; Last Update: March 27, 2007.
  - ^99mTc-Hydrazinonicotinic acid-bitistatin [PDF Version]
    ^99mTc-HYNIC-bitistatin
    Kam Leung.
    Created: July 7, 2007; Last Update: April 25, 2012.
  - ^99mTc-Hydrazinonicotinic acid-cyclo[γ-d-Glu-Ala-Tyr-d-Lys]-Trp-Met-Phe-NH₂ [PDF Version]
    ^99mTc-HYNIC-cyclo-MG1
    Kam Leung.
    Created: February 17, 2010; Last Update: March 25, 2010.
  - ^99mTc-Hydrazinonicotinic acid-Glu-[cyclo(Arg-Gly-Asp-D-Phe-Lys)]₂ [PDF Version]
    ^99mTc-HYNIC-E-[c(RGDfK)]₂
    Kam Leung.
    Created: August 15, 2007; Last Update: September 25, 2007.
  - ^99mTc-Hydrazinonicotinic acid-Glu-{Glu-[cyclo(Arg-Gly-Asp-D-Phe-Lys)]₂}₂ [PDF Version]
    ^99mTc-HYNIC-E{E[c(RGDfK)]₂}₂
    Kam Leung.
    Created: July 15, 2007; Last Update: August 31, 2007.
  - ^99mTc-Hydrazinonicotinic acid-single-chain Cys-tagged vascular endothelial growth factor-121 [PDF Version]
    ^99mTc-HYNIC-scVEGF₁₂₁
    Kam Leung.
    Created: February 17, 2008; Last Update: March 31, 2008.
  - ^99mTc-Hydrazinonicotinyl(tricine)(TPPTS)-Glu-c(RGDyK)-bombesin[7-14]NH₂ [PDF Version]
    ^99mTc-HYNIC-RGD-BBN
    Kam Leung.
    Created: August 16, 2012; Last Update: November 8, 2012.
  - ^99mTc-Interleukin-18-binding protein-Fc-interlukin-1 receptor antagonist [PDF Version]
    ^99mTc-IL-18bp-Fc-IL-1ra
    Kam Leung.
    Created: May 2, 2013; Last Update: May 30, 2013.
  - ^99mTc-Interleukin-2 [PDF Version]
    ^99mTc-IL-2
    Kam Leung.
    Created: September 15, 2006; Last Update: October 12, 2006.
  - ^99mTc-Labeled, PEGylated (N^αHis)Ac-β³hLys-βAla-βAla-Gln⁷-Trp⁸-Ala⁹-Val¹⁰-Gly¹¹-His¹²-Cha¹³-Nle¹⁴-NH₂ [PDF Version]
    ^99mTc-PEG_x-Lys-BN
    Liang Shan.
    Created: March 12, 2012; Last Update: April 11, 2012.
  - ^99mTc-Labeled (1S,3S)-3-acetyl-1,2,3,4,6,11-hexahydro-3,5,12-trihydroxy-10-methoxy-6,11-dioxo-1-naphthacenyl 3-amino-2,3,6-trideoxy-α-l-lyxo-hexopyranoside [PDF Version]
    [^99mTc]Daunorubicin
    Arvind Chopra.
    Created: February 1, 2013; Last Update: February 28, 2013.
  - ^99mTc-labeled [N₄⁰,Pro¹,Tyr⁴]bombesin [PDF Version]
    [^99mTc]Demobesin 3
    Liang Shan.
    Created: September 20, 2009; Last Update: October 28, 2009.
  - ^99mTc-Labeled 13,13’[oxybis[methylene(2,5-dioxo-1,3-pyrrolidinediyl)]]bis[N-(mercaptoacetyl)-D-tyrosyl-S-(3-aminopropyl)-L-cysteinylglycyl-L-α-aspartyl-L-cysteinylglycylglycyl-S-[(acetylamino)methyl]-L-cysteinylglycyl-S-[(acetylamino)methyl-L-cysteinylglycylglycyl-L-cysteinamide],cyclic(1→5),(1’→5’),-bis(sulfide) [PDF Version]
    ^99mTc-apcitide
    Arvind Chopra.
    Created: December 19, 2008; Last Update: January 14, 2009.
  - ^99mTc-Labeled 1-hydroxy-2-(2-ethyl-4-methyl-1H-imidazol-1-yl)ethane-1,1-diyldiphosphonic acid [PDF Version]
    [^99mTc]-EMIDP
    Arvind Chopra.
    Created: July 13, 2010; Last Update: July 29, 2010.
  - ^99mTc-Labeled 1-hydroxy-2-(2-isopropyl-1H-imidazole-1-yl)ethylidene-1,1-bisphosphonic acid [PDF Version]
    [^99mTc]-iPIDP
    Arvind Chopra.
    Created: October 24, 2011; Last Update: November 1, 2011.
  - ^99mTc-Labeled 1-hydroxy-3-(1H-imidazol-1-yl)propane-1,1-diyldiphosphonic acid (IPrDP) [PDF Version]
    [^99mTc]-IPrDP
    Arvind Chopra.
    Created: July 7, 2011; Last Update: September 8, 2011.
  - ^99mTc-Labeled 5-amino-1,3-bis(ethylamine-(N,N-dimethyl diphosphonic acid)acetamido)benzene [PDF Version]
    [^99mTc]IPTMP
    Puja Panwar, Sweta Singh, Nitin Kumar, Harish Rawat, Anil Kumar Mishra, and Arvind Chopra.
    Created: July 10, 2009; Last Update: October 1, 2009.
  - ^99mTc-Labeled 6-hydrazinopyridine-3-carboxylic acid (HYNIC)–conjugated murine anti-MUC1 monoclonal antibody PR81 [PDF Version]
    [^99mTc]-PR81
    Arvind Chopra.
    Created: May 26, 2010; Last Update: June 29, 2010.
  - ^99mTc-Labeled 6-hydrazinopyridine-3-carboxylic acid conjugated to hydroxy-bisphosphonate [PDF Version]
    [^99mTc]HYNIC-HBP
    Arvind Chopra.
    Created: November 6, 2009; Last Update: December 9, 2009.
  - ^99mTc-Labeled acetylated dendrimer poly(amido)-amine generation 5-folic acid-2-(p-isothiocyanatobenzyl)-6-methyl-diethylenetriamine pentaacetic acid conjugate [PDF Version]
    ^99mTc-G5-Ac-FA-DTPA
    Liang Shan.
    Created: March 15, 2011; Last Update: April 21, 2011.
  - ^99mTc-Labeled acetylated dendrimer poly(amido)-amine generation 5-PEGylated folic acid-2-(p-isothiocyanatobenzyl)-6-methyl-diethylenetriamine pentaacetic acid conjugate [PDF Version]
    ^99mTc-G5-Ac-pegFA-DTPA
    Liang Shan.
    Created: March 15, 2011; Last Update: April 21, 2011.
  - ^99mTc-Labeled anti-carcinoembryonic antigen monoclonal antibody CL-58 [PDF Version]
    ^99mTc-Anti-CEA CL-58
    Arvind Chopra.
    Created: July 28, 2008; Last Update: August 27, 2008.
  - ^99mTc-Labeled anti-macrophage mannose receptor (MMR; CD206) nanobody [PDF Version]
    [^99mTc]MMR Nb
    Arvind Chopra.
    Created: September 4, 2012; Last Update: September 27, 2012.
  - ^99mTc-Labeled anti-receptor for advanced glycation endproducts monoclonal antibody F(ab’)₂ fragments [PDF Version]
    ^99mTc-anti-RAGE mF(ab’)₂
    Liang Shan.
    Created: July 16, 2010; Last Update: August 16, 2010.
  - ^99mTc-Labeled anti-receptor for advanced glycation endproducts polyclonal antibody F(ab’)₂ fragments [PDF Version]
    ^99mTc-anti-RAGE pF(ab’)₂
    Liang Shan.
    Created: July 16, 2010; Last Update: August 16, 2010.
  - ^99mTc-labeled anti-tumor necrosis factor-alpha monoclonal antibody [PDF Version]
    ^99mTc-anti-TNF-α mAb
    Arvind Chopra.
    Created: September 25, 2007; Last Update: October 22, 2007.
  - ^99mTc-Labeled citric acid-folate conjugate [PDF Version]
    ^99mTc-Citro-folate
    Liang Shan.
    Created: March 15, 2011; Last Update: April 19, 2011.
  - ^99mTc-Labeled cysteine-tagged dimeric epidermal growth factor [PDF Version]
    [^99mTc]Cys-dEGF
    Arvind Chopra.
    Created: May 18, 2009; Last Update: July 15, 2009.
  - ^99mTc-Labeled cysteine-tagged epidermal growth factor [PDF Version]
    [^99mTc]Cys-EGF
    Arvind Chopra.
    Created: May 18, 2009; Last Update: July 15, 2009.
  - ^99mTc-Labeled doxorubicin [PDF Version]
    ^99mTc-doxorubicin
    Liang Shan.
    Created: December 3, 2012; Last Update: January 2, 2013.
  - ^99mTc-Labeled hydrazinonicotinamide-cysteine-annexin A5 [PDF Version]
    ^99mTc-HYNIC-cys-Annexin A5
    Arvind Chopra.
    Created: January 13, 2010; Last Update: March 4, 2010.
  - ^99mTc-Labeled imine 6-(pyridine-2-methylimine)-4-[(3-bromophenyl)amino]quinazoline [PDF Version]
    [^99mTc]Complex 7
    Arvind Chopra.
    Created: June 18, 2009; Last Update: August 4, 2009.
  - ^99mTc-labeled ior-egf/r3 monoclonal antibody against epidermal growth factor receptor [PDF Version]
    ^99mTc-ior-egf/r3 MAb
    Arvind Chopra.
    Created: June 11, 2007; Last Update: December 19, 2008.
  - ^99mTc-Labeled lexatumumab [PDF Version]
    ^99mTc-EC-HGS-ETR2
    Arvind Chopra.
    Created: March 19, 2009; Last Update: May 20, 2009.
  - ^99mTc-Labeled mannosylated dextran DCM20 [PDF Version]
    ^99mTc(CO)₃-DCM20
    Liang Shan.
    Created: May 16, 2012; Last Update: July 17, 2012.
  - ^99mTc-Labeled mapatumumab [PDF Version]
    ^99mTc-EC-HGS-ETR1
    Arvind Chopra.
    Created: March 16, 2009; Last Update: May 20, 2009.
  - ^99mTc-Labeled mercaptoacetylglycylglycylglycine conjugated to hydroxy-bisphosphonate [PDF Version]
    [^99mTc]MAG3-HBP
    Arvind Chopra.
    Created: November 6, 2009; Last Update: December 9, 2009.
  - ^99mTc-Labeled murine IgM monoclonal antibody, fanolesomab, that targets the CD15 glycoprotein antigen [PDF Version]
    ^99mTc-Fanolesomab
    Arvind Chopra.
    Created: September 19, 2011; Last Update: October 28, 2011.
  - ^99mTc-Labeled N-(triethylammonium)-3-propyl-[15]ane-N5 [PDF Version]
    [^99mTc]NTP 15-5
    Arvind Chopra.
    Created: September 18, 2009; Last Update: December 17, 2009.
  - ^99mTc-Labeled N^ε49 mercaptoacetyl derivatives of affibody Z_HER2:342 targeting the human epidermal growth factor receptor [PDF Version]
    [^99mTc]-N^ε49-maGGG-Z_HER2:342; [^99mTc]-N^ε49-maSSS-Z_HER2:342; [^99mTc]-N^ε49-maESE-Z_HER2:342
    Arvind Chopra.
    Created: January 19, 2010; Last Update: March 4, 2010.
  - ^99mTc-Labeled O-[3-(1,4,8,11-tetraazabicyclohexadecane)-propyl]-α-methyl tyrosine [PDF Version]
    [^99mTc]-N4-AMT
    Arvind Chopra.
    Created: October 26, 2011; Last Update: December 1, 2011.
  - ^99mTc-Labeled peptide derivative of folic acid [PDF Version]
    ^99mTc-EC20
    Arvind Chopra.
    Created: September 11, 2009; Last Update: November 12, 2009.
  - ^99mTc-Labeled poly(ethyleneglycol)–N-(N-(3-diphenylphosphinopropionyl)glycyl)-S-tritylcysteine (PEG-PN₂S)-linked ubiquicidin (UBI) [PDF Version]
    [^99mTc]-PEG-PN₂S-UBI_29-41
    Arvind Chopra.
    Created: September 26, 2011; Last Update: October 28, 2011.
  - ^99mTc-Labeled pyridyl benzofuran derivatives to target β-amyloid plaques [PDF Version]
    [^99mTc]BAT-bp-1, [^99mTc]BAT-bp-2, and [^99mTc]BAT-bp-3
    Arvind Chopra.
    Created: July 11, 2012; Last Update: August 16, 2012.
  - ^99mTc-Labeled rituximab, a chimeric murine/human anti-CD20 monoclonal antibody [PDF Version]
    [^99mTc]Rituximab
    Arvind Chopra.
    Created: September 20, 2012; Last Update: October 25, 2012.
  - ^99mTc-Labeled S-benzoylmercaptoacetyl triglycine d-galactose [PDF Version]
    [^99mTc]SBz-MAG₃-Ga
    Arvind Chopra.
    Created: April 21, 2010; Last Update: May 11, 2010.
  - ^99mTc-Labeled S-benzoylmercaptoacetyl triglycine d-glucose [PDF Version]
    [^99mTc]SBz-MAG₃-Gl
    Arvind Chopra.
    Created: April 21, 2010; Last Update: May 13, 2010.
  - ^99mTc-Labeled S-benzoylmercaptoacetyl triglycine n-acetylglucosamine [PDF Version]
    [^99mTc]SBz-MAG₃-NG
    Arvind Chopra.
    Created: April 21, 2010; Last Update: May 13, 2010.
  - ^99mTc-Labeled succinimidyl-6-hydrazinonicotinate hydrochloride (SHNH)-conjugated visilizumab [PDF Version]
    ^99mTc-SHNH-visilizumab
    Liang Shan.
    Created: December 7, 2009; Last Update: January 12, 2010.
  - ^99mTc-Labeled tetraethylenepentamine-folate [PDF Version]
    ^99mTc-TEPA-Folate
    Puja Panwar, Vibha Srivastava, Vibha Tandon, Pushpa Mishra, Krishna Chuttani, Rakesh Sharma, Ramesh Chandra, Anil Mishra, and Arvind Chopra.
    Created: August 25, 2009; Last Update: October 1, 2009.
  - ^99mTc-Labeled trans-1,2-cyclohexyldinitrilo tetramethylene phosphonic acid [PDF Version]
    [^99mTc]CDTMP
    Puja Panwar, Krishna Chuttani, Pushpa Mishra, Rajnish Sharma, Anupam Mondal, Anil Kumar Mishra, and Arvind Chopra.
    Created: August 19, 2009; Last Update: October 15, 2009.
  - ^99mTc-Labeled tumor-associated glycoprotein 72 binding peptides A2-6 and A3-10 [PDF Version]
    [^99mTc]-A2-6 and [^99mTc]-A3-10
    Arvind Chopra.
    Created: September 13, 2011; Last Update: October 27, 2011.
  - ^99mTc-Labeled tumor-associated glycoprotein 72 binding peptides G3-15 and T3-15 [PDF Version]
    [^99mTc]-G3-15 and [^99mTc]-T3-15
    Arvind Chopra.
    Created: September 13, 2011; Last Update: October 27, 2011.
  - ^99mTc-Mercaptoacetyl-Glu-Glu-aptamer specific for tenascin-C [PDF Version]
    ^99mTc-TTA1
    Huiming Zhang.
    Created: July 17, 2008; Last Update: August 12, 2008.
  - ^99mTc-Mercaptoacetyl-Glu-Glu-Glu-Affibody Z_HER2:342 [PDF Version]
    ^99mTc-MaEEE-Z_HER2:342
    Kam Leung.
    Created: March 16, 2008; Last Update: April 7, 2008.
  - ^99mTc-Mercaptoacetyl-Gly-Gly-Gly-Affibody Z_HER2:342 [PDF Version]
    ^99mTc-MAG3-Z_HER2:342
    Kam Leung.
    Created: January 6, 2008; Last Update: April 5, 2008.
  - ^99mTc-Mercaptoacetyl-Gly-Gly-Gly-PAP-1 [PDF Version]
    ^99mTc-MAG3-PAP-1
    Kam Leung.
    Created: August 8, 2008; Last Update: August 15, 2008.
  - ^99mTc-Mercaptoacetyl-Ser-Ser-Ser-Affibody Z_HER2:342 [PDF Version]
    ^99mTc-MaSSS-Z_HER2:342
    Kam Leung.
    Created: March 11, 2008; Last Update: May 5, 2008.
  - ^99mTc-Methyl diphosphonate [PDF Version]
    ^99mTc-MDP
    Arvind Chopra.
    Created: March 29, 2007; Last Update: August 24, 2009.
  - ^99mTc-Monocyte chemoattractant protein-1 [PDF Version]
    ^99mTc-MCP-1
    Dagmar Hartung, Artiom Petrov, Kenneth T. Cheng, and Jagat Narula.
    Created: February 2, 2008; Last Update: March 26, 2008.
  - ^99mTc-N,N'-Bis(S-benzoyl-thioglycoloyl)diamidopropanoyl-KRAS-PNA-d(Cys-Ser-Lys-Cys) [PDF Version]
    ^99mTc-WT4351
    Kenneth T. Cheng, Atis Chakrabarti, Mohan R. Aruva, Mathew L. Thakur, and Eric Wickstrom.
    Created: August 9, 2007; Last Update: January 3, 2008.
  - ^99mTc-N₂S₂-Tat(49-57)-Lys³-bombesin [PDF Version]
    ^99mTc-Tat-BN
    Liang Shan.
    Created: August 10, 2009; Last Update: September 23, 2009.
  - ^99mTc-Nicotinic acid/tricine/hydrazinonicotinamide-nonsulfated cholecystokinin-8 [PDF Version]
    ^99mTc-NA/tricine/HYNIC-nsCCK-8
    Kenneth T. Cheng and Peter Laverman.
    Created: August 31, 2007; Last Update: September 25, 2007.
  - ^99mTc-Nicotinic acid/tricine/hydrazinonicotinamide-sulfated cholecystokinin-8 [PDF Version]
    ^99mTc-NA/tricine/HYNIC-sCCK-8
    Kenneth T. Cheng and Peter Laverman.
    Created: August 18, 2007; Last Update: September 13, 2007.
  - ^99mTcO-N,N-Dimethylglycyl-l-lysinyl-l-cysteinylamide-8-amino-3,6-dioxaoctanoic-probestin [PDF Version]
    ^99mTcO-N₃S-PEG₂-probestin
    Kam Leung.
    Created: January 15, 2012; Last Update: April 12, 2012.
  - ^99mTc-pGlu-Gln-Trp-Ala-Val-Gly-His-Phe-Met-NH2 [PDF Version]
    ^99mTc-Litorin
    Kam Leung.
    Created: October 1, 2007; Last Update: December 24, 2007.
  - ^99mTc-Regioselectively addressable functionalized template-[cyclo-(Arg-Gly-Asp-d-Phe-Lys)]₄ [PDF Version]
    ^99mTc-RAFT-c(-RGDfK-)₄
    Kam Leung.
    Created: February 9, 2008; Last Update: May 8, 2008.
  - ^99mTc-S-acetylmercaptoacetyltriserine-stromal-derived factor 1α [PDF Version]
    ^99mTc-MAS₃-SDF-1α
    Arvind Chopra.
    Created: June 11, 2008; Last Update: July 22, 2008.
  - ^99mTc-succinimidyl-6-hydrazinopyridine-3-carboxylate-interleukin 12 [PDF Version]
    ^99mTc-IL-12
    Arvind Chopra.
    Created: October 5, 2007; Last Update: November 13, 2007.
  - ^99mTc-Tricarbonyl-His₆-annexin A5 [PDF Version]
    ^99mTc(CO)₃-His-A5
    Kam Leung.
    Created: April 19, 2012; Last Update: July 19, 2012.
  - ^99mTc-Tricarbonyl-K-H-K-H-cholecystokinin 8 [PDF Version]
    [^99mTc](KH)₂CCK8
    Arvind Chopra.
    Created: July 14, 2008; Last Update: August 27, 2008.
  - ^99mTc-Tricarbonyl–labeled aspartic-N-monoacetic acid (ASMA) [PDF Version]
    [^99mTc](CO)₃(ASMA)
    Arvind Chopra.
    Created: August 2, 2012; Last Update: September 13, 2012.
  - ^99mTc-Type II tumor necrosis receptor-Fc-interlukin-1 receptor antagonist fusion protein [PDF Version]
    ^99mTc-TNFR2-Fc-IL-1ra
    Kam Leung.
    Created: May 1, 2013; Last Update: May 30, 2013.
  - ^99mTc-Ubiquicidin_29-41 [PDF Version]
    ^99mTc-UBI_29-41
    The MICAD Research Team.
    Created: July 31, 2007; Last Update: September 6, 2007.
  - ^99mTc≡Nitrido(diphosphine)-Cys-β-Ala-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH₂ [PDF Version]
    ^99mTcN(PNP6)-Cys-β-Ala-BBN(7-14)NH₂
    Kam Leung.
    Created: December 5, 2008; Last Update: January 16, 2009.
  - Acetyl-lys-lys-lys-lys-lys-cys-gly-cys-gly-gly-pro-leu-tyr-lys-lys-ile-ile-lys-lys-leu-leu-glu-ser-heparin-[^99mTc] [PDF Version]
    P483H-^99mTc
    Arvind Chopra.
    Created: November 14, 2007; Last Update: December 20, 2007.
  - N-[2-(N-(2-mercaptoethyl)) amino ethyl]-N-(2-mercaptoethyl)-3,5-dimethylacetamide amantadine-technetium [PDF Version]
    ^99mTc-NCAM
    Liang Shan.
    Created: June 12, 2012; Last Update: July 17, 2012.
  - Tricarbonyl[^99mTc]technetium(I)-((S)-6-(8-(bis(pyridin-2-ylmethyl)amino)octanamido)-2-((S)-1-carboxy-3-phenylpropylamino)hexanoyl)pyrrolidine-2-carboxylic acid [PDF Version]
    ^99mTc-(CO)₃D(C₈)lisinopril
    Arvind Chopra.
    Created: June 25, 2008; Last Update: July 29, 2008.
  - Tri-methoxy-tris-pyrazolyl-^99mTc-(CO)₃ [PDF Version]
    ^99mTc-TMEOP
    Liang Shan.
    Created: March 27, 2012; Last Update: April 25, 2012.
Ultrasound
- Dye
  - 3,7-bis(dimethylamino)-phenothiazin-5-ium chloride [PDF Version]
    Methylene blue
    Arvind Chopra.
    Created: April 5, 2011; Last Update: April 29, 2011.
- Gold
  - Gold nanocages [PDF Version]
    Au nanocages
    Kam Leung.
    Created: March 19, 2011; Last Update: June 2, 2011.
  - Poly(ethylene glycol)-coated gold nanocages [PDF Version]
    PEG-AuNCs
    Kam Leung.
    Created: March 19, 2011; Last Update: June 2, 2011.
  - Poly(ethylene glycol)-coated gold nanocages bioconjugated with [Nle⁴,d-Phe⁷]-α-melanotropin-stimulating hormone [PDF Version]
    [Nle⁴,d-Phe⁷]-α-MSH-PEG-AuNCs
    Kam Leung.
    Created: May 29, 2011; Last Update: July 14, 2011.
  - Polyethylene glycol–coated (PEG5000) gold nanoparticles [PDF Version]
    PEGylated gold nanoparticles
    Liang Shan.
    Created: June 17, 2010; Last Update: November 17, 2010.
- ICG
  - Indocyanine green–enhanced, cyclic Arg-Gly-Asp–conjugated, PEGylated single-walled carbon nanotubes [PDF Version]
    SWNT-ICG-RGD
    Liang Shan.
    Created: June 2, 2010; Last Update: July 12, 2010.
- Microbubbles
  - Abciximab microbubbles [PDF Version]
    MB_Abc
    Kam Leung.
    Created: April 26, 2007; Last Update: February 26, 2008.
  - Air-filled, cross-linked, human serum albumin microcapsules [PDF Version]
    Air-filled HSA microcapsules
    Kenneth T. Cheng.
    Created: July 6, 2006; Last Update: May 8, 2008.
  - Anti-ligand–induced binding sites (LIBS) single-chain antibody conjugated to microbubbles [PDF Version]
    LIBS-MBs
    Kam Leung.
    Created: October 21, 2012; Last Update: February 28, 2013.
  - Anti-vascular cell adhesion molecule-1 monoclonal antibody M/K-2.7 microbubbles [PDF Version]
    MB_VCAM-1
    Kam Leung.
    Created: November 20, 2007; Last Update: January 15, 2008.
  - Buried cyclo(Arg-Gly-Tyr(Me)-Lys-Glu) microbubbles [PDF Version]
    bRGD-MBs
    Huiming Zhang.
    Created: June 2, 2008; Last Update: July 21, 2008.
  - Magnetic microbubbles conjugated with anti-vascular cell adhesion molecule-1 monoclonal antibody 429 [PDF Version]
    MBvM
    Kam Leung.
    Created: February 27, 2012; Last Update: June 14, 2012.
  - Microbubble-conjugated vascular endothelial growth factor receptor 2 binding peptide [PDF Version]
    BR55
    Adrian Nunn, Sibylle Pochon, Isabelle Tardy, Francois Tranquart, and Arvind Chopra.
    Created: February 14, 2012; Last Update: July 11, 2012.
  - Microbubble-conjugated vascular endothelial growth factor receptor 2 monoclonal antibody [PDF Version]
    Arvind Chopra.
    Created: November 5, 2007; Last Update: December 12, 2007.
  - Microbubbles coated with antibody to intracellular adhesion molecule-1 [PDF Version]
    MB_ICAM-1
    Kam Leung.
    Created: December 21, 2006; Last Update: April 17, 2012.
  - Microbubbles coated with antibody to mucosal addressin cellular adhesion molecule-1 [PDF Version]
    MB_MAdCAM-1
    Kam Leung.
    Created: February 9, 2007; Last Update: February 27, 2007.
  - Microbubbles coated with anti-P-selectin antibody RB40.34 [PDF Version]
    MB-RB40.34
    Kam Leung.
    Created: December 21, 2006; Last Update: April 17, 2012.
  - Microbubbles coated with biotinylated rabbit anti-mouse endoglin monoclonal antibody [PDF Version]
    MB_endoglin
    Arvind Chopra.
    Created: September 6, 2011; Last Update: September 29, 2011.
  - Microbubbles coated with biotinylated rabbit anti-mouse vascular endothelial growth factor receptor 2 (VEGFR-2) monoclonal antibody [PDF Version]
    MB_vegfr2
    Arvind Chopra.
    Created: September 12, 2011; Last Update: September 29, 2011.
  - Microbubbles coated with biotinylated rabbit anti-mouse α_Vβ₃ integrin monoclonal antibody [PDF Version]
    MB_integrin
    Arvind Chopra.
    Created: September 12, 2011; Last Update: September 29, 2011.
  - Microbubbles conjugated with anti-matrix metalloproteinase 2 mouse monoclonal antibody sc-13595 [PDF Version]
    MMP2-MBs
    Kam Leung.
    Created: August 15, 2011; Last Update: November 17, 2011.
  - Microbubbles conjugated with anti-vascular cell adhesion molecule-1 nanobody cAbVCAM1-5 [PDF Version]
    MB-cAbVCAM1-5
    Kam Leung.
    Created: March 3, 2012; Last Update: June 14, 2012.
  - Microbubbles conjugated with cyclo(CGGRRLGGC) [PDF Version]
    MB_RRL
    Kam Leung.
    Created: June 30, 2008.
  - Microbubbles conjugated with knottin 2.5D [PDF Version]
    MB_Knottin
    Kam Leung.
    Created: October 20, 2010; Last Update: December 9, 2010.
  - Microbubbles conjugated with single-chain Cys-tagged vascular endothelial growth factor-121 [PDF Version]
    scVEGF-MBs
    Kam Leung.
    Created: December 15, 2010; Last Update: February 24, 2011.
  - Microbubbles-echistatin [PDF Version]
    MB_E
    Kam Leung.
    Created: February 18, 2005; Last Update: January 11, 2012.
  - Microbubbles with a disteroylphosphatidylcholine, disteroylphosphatidylethanolamine-polyethyleneglycol (PEG) 2000-pyridyldithio propionate-PEG 40 stearate shell conjugated to cyclic arginine-glycine-aspartic acid-d-tyrosine-lysine (cRGD) pentapeptide [PDF Version]
    cRGD-MB
    Arvind Chopra.
    Created: March 28, 2011; Last Update: April 28, 2011.
  - Perflexane-Lipid Microspheres [PDF Version]
    AFO150
    Kenneth T. Cheng.
    Created: November 1, 2005; Last Update: May 13, 2008.
  - Perflutren lipid microspheres [PDF Version]
    DMP 115
    Kenneth T. Cheng.
    Created: February 24, 2006; Last Update: November 21, 2007.
  - Sonicated human serum microspheres [PDF Version]
    Sonicated HSM
    Kenneth T. Cheng.
    Created: March 20, 2006; Last Update: May 27, 2008.
  - Stabilized sulfur hexafluoride microbubbles [PDF Version]
    SF₆ Microbubbles
    Kenneth T. Cheng.
    Created: September 21, 2006; Last Update: February 25, 2008.
- Nanobubbles
  - Perfluoropropane-filled, sorbitan monostearate– and polyoxyethylene 40 stearate–shelled nanobubbles [PDF Version]
    PFC-S60-PEG40S-NB
    Liang Shan.
    Created: August 2, 2010; Last Update: September 1, 2010.
X-Ray, CT
- Au
  - Gold nanoparticles [PDF Version]
    AuNPs
    Kam Leung.
    Created: October 26, 2006; Last Update: March 8, 2011.
  - Polyethylene glycol-gold nanoparticles [PDF Version]
    PEG-AuNPs
    Kam Leung.
    Created: May 26, 2008; Last Update: June 9, 2008.
- Bi
  - Bismuth sulphide polyvinylpyrrolidone nanoparticles [PDF Version]
    BPNPs
    Kam Leung.
    Created: October 26, 2006; Last Update: November 11, 2007.
- Iodine
  - (S)-N,N’-bis[2-hydroxy-1-(hydroxymethyl)-ethyl-2,4,6-triiodo-5-lactamidoisophthalamide [PDF Version]
    Iopamidol
    The MICAD Research Team.
    Created: April 3, 2007; Last Update: April 17, 2007.
  - 1,3-Bis-[7-(3-amino-2,4,6-triiodophenyl)-heptanoyl]-2-oleoyl glycerol [PDF Version]
    DHOG
    Cynthia Burrascano, William C. Dow, and Arvind Chopra.
    Created: August 29, 2007; Last Update: December 18, 2007.
  - 5-[3-Hydroxy-2-hydroxymethyl-propionamido)-N,N´-dimethyl-N,N´-bis-(2,3-dihydroxypropyl)-2,4,6-triiodoisophthalamide [PDF Version]
    Iobitridol
    Kenneth T. Cheng.
    Created: May 16, 2006; Last Update: April 21, 2008.
  - Ethyl-3,5-bis(acetylamino)-2,4,6-triiodobenzoate nanoparticles [PDF Version]
    N1177
    Huiming Zhang.
    Created: June 10, 2008; Last Update: July 30, 2008.
  - Ioxilan carbonate particles [PDF Version]
    IX-C particles
    Kenneth T. Cheng.
    Created: September 1, 2007; Last Update: December 18, 2007.
  - Lipiodol-loaded poly(oxyethylene)-block-poly(oxypropylene)-block-poly(oxyethylene) triblock copolymers/polyethylene glycol-nanoparticles [PDF Version]
    LPNCs
    Kenneth T. Cheng.
    Created: January 9, 2008; Last Update: February 18, 2008.
  - N,N´-Bis(2,3-dihydroxypropyl)-5-[N-(2-hydroxyethyl)-glycolamidol]-2,4,6-triiodoisophthalamide [PDF Version]
    Ioversol
    Kenneth T. Cheng.
    Created: February 7, 2006; Last Update: February 7, 2008.
  - N,N´-Bis(2,3-dihydroxypropyl)-5-[N-(2-hydroxyethyl-3-methoxypropyl)-acetamidol]-2,4,6-triiodoisophthalamide [PDF Version]
    Iopentol
    Kenneth T. Cheng.
    Created: March 6, 2006; Last Update: March 4, 2008.
  - N-(2,3-Dihydroxypropyl)-N´-(2-hydroxyethyl)-5-[N-(2,3-dihydroxypropyl)acetamido]-2,4,6-triiodoisophthalamide [PDF Version]
    Ioxilan
    The MICAD Research Team.
    Created: July 12, 2006; Last Update: August 9, 2006.
  - Sodium-2-[(3-butanoylamino-2,4,6-triiodo-phenyl)methyl]butanoate [PDF Version]
    Tyropanoate Sodium
    Kenneth T. Cheng.
    Created: October 5, 2005; Last Update: June 30, 2008.

Bookshelf ID: NBK5330PMID: 20641179

< PrevNext >

PubReader
Print View
Cite this Page
Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
MICAD summary (CSV file)

Search MICAD

Search term

Limit my Search:

Method of detection:

Source of signal/contrast:

Agent Category:

Target Category:

In vitroRodentsNon-primate non-rodent mammals
Non-human primatesHumansAny

Related information

NLM Catalog
Related NLM Catalog Entries

Recent Activity

Clear Turn Off Turn On

Molecular Imaging and Contrast Agent Database (MICAD)
Molecular Imaging and Contrast Agent Database (MICAD)
2361ex4-5 class I gene fragment 2361 [Rattus norvegicus]
2361ex4-5 class I gene fragment 2361 [Rattus norvegicus]
Gene ID:415060
Gene

Your browsing activity is empty.

Activity recording is turned off.

Turn recording back on

Bookshelf

Molecular Imaging and Contrast Agent Database (MICAD)

Contents

Views

Search MICAD

Related information

Similar articles in PubMed

Recent Activity