Conserved Protein Domain Family
CUE_Cue1p_like

?
cd14424: CUE_Cue1p_like 
CUE domain found in yeast ubiquitin-binding protein CUE1 (Cue1p), CUE4 (Cue4p) and similar proteins
Cue1p, also called coupling of ubiquitin conjugation to ER degradation protein 1 or kinetochore-defect suppressor 4, is encoded by the open reading frame (ORF) YMR264W in yeast. It is an N-terminally membrane-anchored endoplasmic reticulum (ER) protein essential for the activity of the two major yeast RING finger ubiquitin ligases (E3s) implicated in ER-associated degradation (ERAD). It interacts with the ERAD ubiquitin-conjugating enzyme (E2) Ubc7p in vivo, stimulates Ubc7p E2 activity, and further activates ER-associated protein degradation. Cue1p contains a CUE domain which binds ubiquitin much more weakly than those of other CUE domain containing proteins. It also has an Ubc7p binding-domain at the C-terminal region which is required for Ubc7p-dependent ubiquitylation and for degradation of substrates in the ER. This family also includes Cue4p, also called coupling of ubiquitin conjugation to ER degradation protein 4. It is encoded by the open reading frame (ORF) YML101C in yeast. Cue4p contains a CUE domain which shows high level of similarity with that of Cue1p.
Statistics
?
PSSM-Id: 270607
Aligned: 24 rows
Threshold Bit Score: 45.582
Created: 4-Apr-2013
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P38428                 67 TQMVETVQNLAPNLHPEQIRYSLENTGSVEETVERYL 103 Saccharomyces cerevisiae S288c
CCM01253               46 IEMVETVHNMFPDIPSDNIRYDLLRTGNVQQTTNTIL 82  Fibroporia radiculosa
WGS:AACO:CNAG_05533T0  39 PSMVETVHSAFPHVPVPNIVYHLSRTRSAQATSEEIL 75  Cryptococcus neoformans var. grubii H99
Q04201                 76 SDMVEIVMTMAPHVPQEKVVQDLRNTGSIEHTMENIF 112 Saccharomyces cerevisiae S288c
Q4PD73                 48 QHMVDSIKALFPHIPDASIRYDLQRSGSVEETCERIL 84  Ustilago maydis
EIN05481               42 DEMAHRVADIYPDIPRDNIRYDLLRTGDVAVTSEKIL 78  Punctularia strigosozonata HHB-11173 SS5
EIE80293               30 PQMIETVRAMFPDIPIAAIQADLQRTGSVETTVDNAL 66  Rhizopus oryzae RA 99-880
EGF77097               50 LSSVDAVFSMFPHIPRATIELDLSNTGSVEETCDRIL 86  Batrachochytrium dendrobatidis JAM81
CCO37676               49 PEMIASVRSAFPQESIDNIRYDLLRSGSVEITSNKIL 85  Rhizoctonia solani AG-1 IB
CCA73027               51 PDMIESVRSAFPDIPTANIHYHLLRSGSVETTVNTLL 87  Piriformospora indica DSM 11827
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap