2BZB


Conserved Protein Domain Family
SpoOE-like

?
pfam09388: SpoOE-like (this model, PSSM-Id:401369 is obsolete and has been replaced by 462783)
Click on image for an interactive view with Cn3D
Spo0E like sporulation regulatory protein
Spore formation is an extreme response to starvation and can also be a component of disease transmission. Sporulation is controlled by an expanded two-component system where starvation signals result in sensor kinase activation and phosphorylation of the master sporulation response regulator Spo0A. Phosphatases such as Spo0E dephosphorylate Spo0A thereby inhibiting sporulation. This is a family of Spo0E-like phosphatases. The structure of a Bacillus anthracis member of this family has revealed an anti-parallel alpha-helical structure.
Statistics
?
PSSM-Id: 401369
Aligned: 160 rows
Threshold Bit Score: 25.4406
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BZB_B            7 KNKIENKKKELIQLVARH--GLDHDKVLLFSRDLDKLINKFMN 47  Bacillus anthracis str. Ames
jgi:TepRe1_1128   5 AQEIDEAKGELYSALEAEk-SLINKKVYFLSSKLDKLILEYQL 46  Tepidanaerobacter acetatoxydans Re1
BAH41701         13 TQIIKNLQYQLKEV-FKQqgKLTNSDVLKISQELDEYILEYQR 54  Brevibacillus brevis NBRC 100599
jgi:Halha_2171    5 KEEIKQLKRDMEER-VDQsdDLLADEVYNLSQELDEKILAYYK 46  Halobacteroides halobius DSM 5150
jgi:Toce_0939    10 STEIGNLKRKLNEK-LEKk-NLLAHEVYAISIELDKLILAYQR 50  Thermosediminibacter oceani DSM 16646
WP_014253623    251 LMEIEKLRDELNKKVSKEsqGINNEETLKVSEKLDELITKYLK 293 Hungateiclostridium clariflavum
jgi:Clocl_0181  252 LQEIEKLRDELNKKVTLEgkGINNEETLKLSQKLDEFITRYli 294 Hungateiclostridium clariflavum DSM 19732
jgi:Amet_1015     8 EQKIKLLKKELSKY-TENkdVFLTPKMLNISKKIDEFIIKYGK 49  Alkaliphilus metalliredigens QYMF
jgi:Amet_2444    12 NLEIQNVRHQLQELIKSKegNLLDSKVLDLSEYLDSLVVKYAN 54  Alkaliphilus metalliredigens QYMF
jgi:CAETHG_0289   9 DVEINNLKETLYLL-MKTs-SLTDEIVVKCSEKLDRLILQYQK 49  Clostridium autoethanogenum DSM 10061
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap