#ID = protein locus name
#PROTEIN_NAME = protein name according to locus name search of Cyanidioschyzon merolae database at http://merolae.biol.s.u-tokyo.ac.jp/ on July 8, 2008.
#SEQUENCE = protein sequence
ID	PROTEIN_NAME	SEQUENCE
CMP249C	probable endothelin converting enzyme-1	MSVPSERSPLFGRGTLDQEAGSRDVGSDGANMSAVARQAVTERGRRVRRTLVLVAIGTALLLLLFISYSRESGNKSYAGPGGAGGTQGTNETQDRVLREIRAFINPQEDPCEDFYAYACGGFLRSQPIPPNEARWGTSDLMEERCSDALLPMVQALRSGRAVSRTASEQRVVDFFDACFAAGQPSAADIERSGEDGLANDASSELLNASGFGRILSQLETIADPTELFAILGEMHRSVVDPGGNLPRPFFSYEVLPDGMHPEVMVLTIEQGGLGLPTRDYYLDEYYKDILDEYSNHIGRMLTLSGTDQAEAMQAAANIVEWETELAKASEAEADLGDDAWAVYNPTNLTALQHEMAPAIPWTNYLESLLAGTGKNASAIPLVVQWPPFLKRLSDMVALSSISNETRKLSLYLRWHVLNAMAGAAGNSSLAAEHFRFFGQIVEGRRGLANLSSQCLALADAHIGDDLGRLYVQRFFSPELRGKAVELIRSIEEEFAVILKRDDGAWLGRSSLRAALEKLRLVQNNIGYPDRWPDYDTLHLNGSDLLGDVFLCRQFRNDAILKQIGGPRNPSLWDMTPITVNAYYDPLSNSMNIPAANFAPNFYSALYPEAVNYGALGNVIGHELGHAFDSGGRHYDAHGRLSNWMSPQAVQEYDRRAKCMTNLYDHFRVNGRPVNGRLTLQENLADLTGMKTAYAAYNRLVKEHLTEAARHREWNLTRRIRPDWTPEQLYFVAFAQTWCENETPKYAMEGLVVDVHAPNRYRVNGILSQFPEFAEAFRCRSGSAMHPRKVCALW
CMG087C	similar to lysosomal sphingomyelin phosphodiesterase	MASGSGSDERVPLLGERGRPTGAVAATAAETAHSRDPVGRAQSDRERVCLASRGRRAHRLDELCFWLIYAVLLVASIVWALISAKMRGHQRLQGEPVVPEPAVANTESASFCQVGSTGWNKHRTRLGWSCTSELRSRVTLGRAVSQSAPLSILEKVKSTCPNWRRLLQYPALCRRQERSVSGCGSFLWISDLHVDYWFDPRVPPTLCGERKVCRPAELVYNVSSQVRDASIPNNPAVPVRDVATTYTYGRPGCDPPLPLLESLTEAMKKVDSDPDFILITGDLAPHDLPSRAYVLRSLNASAQHLSATVCGALGNSGESQRRSPRCIVVVGNVDLFPTLHIPIEAKPVSSAERYDAENNNQPVRFRDLYELYVTAGILDPENEALRRSFTVGGYYRAYDDGKLRVLVYNSLHYIAGRLFSSASALNRTNASPALPFYALPCEQWKQVLPDADDPAGQFAWLEEELQDAEQNGRSVFLASHIGPGSKTGSRAWCAPYVTRFADLLTKYADTVTMQFYGDLSREELRLIEPYGSPNGTSEMRGLALLINPGLTPRRMPGGAPTFRHCFFDRGIHRAKQVAQRRRGDHVFAPVTLLDYHAYAFPLQHTVIERMTRGASAPHPEWRWRYSFAEQFCVPHLSASTLRQVIQNIASEPEFMEAYTLRTEDGLESDLDLSAAVGSLRVQPAA
CMT279C	similar to prostatic acid phosphatase precursor	MWGRELFSIVFFAVLVLLVAIHILGSADVVRAFQQGLEHRLTVESKEAWLGGVPLGDVSSYVVPRNASPYESLHSEGKVKAVVIVARHCDRAPQNYAPAYATGTRRRPYKPFPFDKTKWDVDYGELTALGMYQCYRFGRFLHERYVQGHPNDRLLRARYNHEETHVRATDVDRTLVSAAAVMHGLYPAASNPSHQRRHRYSKKQYHIPGGFQYVPIHTRLYGDDRLLDGSGKGRCQLWDIVSKKMLKSDFVYGELQRRSDLYAALPSLANVSVEAFQSMKKKKKLALAATLRDIRICQKSHSIPAPATVSRFDADLEVLTARLNGAKWDASGLGPLVGGRLLRSISTRLATAIEADNGNVQVLARAKDECNRKGHDGDEIGNCYRKLVYYSGHDTTIFDIRAALGVTAIEDGIAPYASHVIFELRRTGPEENDFRVSVYAGHYDQKPRPLFGPFCDGNFSCTASSFFSWVLNTVPNNVSEACIRTERAPDILRRALGNVAKEDNAFQSGHKAVREQSASGGAFSRQFARVLIIGTIGFILVLSAPIVFRLRRTSIRSEYAAV
CMR432C	similar to cation transporting ATPase	MGQHYCGAFRPQLWILDDDLSSETRTSENFTPSERTYGTEQSTWSVSTRSGASDGTQASPMDTSQAAADDDEDALEFEQQNIEERLEGFEAFADQYWRIVVYILLNLLTCGLVYAALQSFPSTKVRLLYRRATNLAEATMLLVTFRRKSRQNKGHYFVIPSEPRARVPSSVLSAYLGRLSTRTILGQSARGRETLRLLSEPVETVLVIEARQRRYLLIQLSGWRHAGQRGMHQRFICLRIHSAFIPAFEEYYRLPTDESSLITPSMHPIPEHEVALPVAGFHEEDEAAWDRPSDPRGNQESAVADVEDPAAPEAEVQPASLVLHRPLGIDLLEADVIRAIVGDNSIEVEMAPLLRLFLQSVTHPFFLFQFFSIALWILEAYYYYSATIAFASFMSALLEAMEMRSNAERLARIAASEGDVLVIRRSPTNRSCDCCERISSRELVPGDVIIVESGMVMPCDCTLLQGSAVVTEANLTGEAAPLFKSSWHSAYEEPSSRVPPRIPIESYQHSSGLAAVSEVTTQEASAHQGAESSAHFINMEESEGNEEDEQSSGESEGYFMGAYSASNEAEDLLPTPAFHHMSVGGLSAWLQPASAAEASAVGSALDASVEHSYTTAAATTAAATAPAAAGADADVNVRQVSRDGERYRRERGARSVPRMMTAGRQHQAPAAHHLAWDQVNHVLYAGTRVIEARPERSVPSTQQSTAAATDAGFSSAGTWQGTGITGADNGASATPATDDQMQSLDSAVLALVIRTRLDTAKGTLLHQILLADDQTSSYERGNPGPRDTRDTKLSVWAALWRRLRSRSPPGDAHLGDGELDDPESSDKRLSQMYLDAYKAMVVLLFGGVLATVYSFTLLRPLLSFREALLSALDVLTIVVPPALPAAVTFGIVFALERLLAAQIYCIRPPAVLIASGIEALCFDKTGTLTDLGLDIHEILPVASMPLALETLPGIQVSSDPPGGITTAATEGTIALFDTEHVIRRHDLTEEGAAPEHQPAPSGYAARLPAGLALVMSCCHTLTVVHGQVLGDEVDSRLFELTGCELRPTASPADSRRWQGIHPAQTLFYVAERHAESSFGRVVKIFAFSSEYARMGVIVQRLVTPESEQPPQVEWLFLVKGAPEVVVNFCDRRSVPSDFSHQVQLYTSQGLRVLALAGRRLLTTDARARRVRLDAAAQALTKRNRSLGTREGAPTAPAAEPPGRAQTARNATPLTWSRQRLERSLTLYGLAVLENRLKPDTAAALHELRHRADLHCLMVTGDHIRTAVSVARQSGMMDRDARVIIADELNAQLVQRRRQCTRLSSFASANAQSAVPGNAGGGNVVVPVDTTTSQVVFSDSMHVQKRFSRMEVFSLLAASPCSARLNRLLNRSSALGVRIMERAPLVAWEAEQPAGFPGAVPEDAPMTSFQGTTHSTEATTEAGVFRSRTRSLRSEAMLRDTRSAQPGYGRRTAGSTAAAAEQSDEGLVGATGVSAGTSGAEVTTLARGRLSEAKTHPALLLREAEAAEAAPLEQHAAVADEAAVPPLPNRRHSLWTGERAGTSALSSVATARVALPQDEPVALAMTGAAFRLLLREFHRLSGSLARSRTPGASSGVGVGGVGGSCGGSRTSSRRYHFLRQVFLRCTVYARMSAADKTALVHLLRSRFGLCVGMCGDGANDAGALREADVGVGLVERRVWSTSESQASGEAPLERIRIEKPDALAREYGDSRAPKATGTKRDLLLLQRLRPKSSSSAVAGDDEDAVASLAAHFTSQVTSIRAVVKVLTEGRGAAAASLACFKYMGIYSLTQSISTLFLYRIGTVYSDGQFLFQDLVLIMPLALTMGRTASQTRLSRHRPPVRLASAPVCWSMVLQSLVQASFQAAAVYALTQADTVPGSVFGMTCRWNAPCPAATVLFHVVNAQYIWSAIAFNMKSPFRQSWEQNPWFRTTLALLSLLCLSVIEPVVPLLQRMLALAPLSTSMRRWLWVLIALNGLATLLVEAVLNWYEHGRVRVSVEEY
CMD095C	V-type ATPase V0 subunit a	MFRSEDIVLLRVYFQRTAAHDCVEELGRRGLVEFRDLNANTSALQRTFAAELKLCDELQRKLRFLSEQANKYLPSEKTFTTLAAQSQQLIEAGPGYSRVQATDTVTLEDLNGQLRRLEADLEEMNLHWDALQSELITIREHGYVLELGEAIFSEARTQRISVSQYGTLPLLESNVLTGEDVISERRGPPDDSESAGQRVERGQGQGYTPVNAVLNVFAGTIAAKHLEAFSRMVFRVSRGNCFLRWVSIPEPIFDIERNESVAKTVFVLFFPGQHLRSKLTRICEGFGATRYPFPDSTGERDRLKTELVIRRQELEAIIETTQRQRADVLGEVATNVTFWTEKVAKEKAIYFTLDKLNYDVSERVFVGECWCPRAEIEEARAAIHIGDIRSNAQAPSIMEECATDEAPPTFFRCNRFTAVWQDIVEAYGIAAYKEMNPAPWSIATFPFLFAIMFGDVGHGMLMTVAALYVVFRERQWRYRKLGDLLQTMYDGRYLILMMGVFSMFTGLIYNECFGVPINLFGSTWKWVDGSAVACGIDHCEQPKLGMPPKRTYPFGFDPAWKIAENSLTMLNSFKMKMSIGFAVAQMTLGIILSYSNARYFAQSLDIWHVFVPQILFFLAIFGYLLLLIFLKWSTDWNAPGASSPPDLKAVLIAMFMSPGSLPRSLRLFPGQHVVQLVLLAIAIVTVPWMLLAKPLVLRRRMRTQRPHAYTPLHNGDRRDAPANLNSSEAESRKAEPHESVGNFAEIFVNNMIHTIEFVLGAISNTASYLRLWALSLAHAELTDVFLQKILYTALATENVIATMIGFVLWFGLTVGVLMLMESLSAFLHALRLHWVEFQNKFYNIHGSGVKFTPLRL
CMO102C	vacuolar-type H+translocating inorganic pyrophosphatase	MFTAGFILAVLAVIAFGTLIFTYRLYEYLIGCPEGPQSMRDVARPIQEGASGFFKVQYSTIASIAGIFALVIYFFGTGGAGGTTQASPFFNAAAFLLGGTLSALSGVLTMYLAVRVNVRVAAAASRSYAEAMKVCFRGGLFGGLLILSNCLVGFILLYWFALVTGMAAGDITQVPVLFVGYAFGASFVALFAQLGGGIYTKAADVGADMVGKVDTGIPEDDPRNPATIADLVGDNVGDASGRSCDLFESISAELVGASILGGTLARTANLSGASQAAYVLFPLCVHAVGLVCSALGGVTVRVSSGVARDEERSLLRTDDAFETRLEDPMSIMKRGFRVTMVLAAISIWVLCWLLLRVGNVAPSAWWHYALCGMIGLAVSYLYVLITEYYTDTKFRPVRSIAEASEYGHGTNVIRMLAVGLESSALPAIVVSAAILGAYWLGATSGMPDRNAAGIFGTAVATMGMLSSAGIVLAMDVFGPVADNAGGIAEMSGADPSVRRITDRLDAAGNSTKAFTKGFAVGSAALAGYLLFSSFMEEMSAQLPEKMVFNSVDLAKPEVFVAGLLGAAVVFLFSSLAMTAVGRAAQGVVAEVRRQFRDHPGIMAGTEKPEYERCVALVAASALRQMVLPGLLPVLAPIMIGMLFRFIGNMTGRPLLGLECAAGLLMVATIAGILMALFMNNAGGAADNAKKYIEDGHYGGKGSQAHKASVTGDTVGDPLKDTAGPSLHVLIKMLSTLTMVFGPAFVGSIGA
CMS342C	V-type ATPase V1 subunit A	MVATDKARGVVQAVSGPVVVARDCPASMYELVRVGHERIVGEVIRLEGSSVTIQCYEATDALAVGDPVERTGMPLTVELGPGLMSSIFDGISRPLEKIATLSGSVFIPRGVDVPSLDRERQWYFEPDPALSVGRLVTGGDWIGSVQETPLILHRIMVPPGTMGTVEWIAPSGWYTITDTVLKVSHQGVSKALSMMQRWPVRQPRPIAEKLVANTPLITGQRVLDTLFPCVQGGTCAVPGAFGVGKTVISQALSKYSNSDGIVYVGCGERGNEMAEVLRDFPELTMSLADGEQVSIMNRTLLVANTSNMPVAAREASIYTGITIAEYYRDMGHDMSMMADSTSRWAEALREISGRLAEMPADSGFPAYLAARLASFYERAGRVKCLGSPERTGSVTVVGAVSPPGGDFSDPVTTATLSTVSVFWGLDKRLASRKFFPAVNTNISWSKNIQALEPWYDAHYPEFPSIRQTVRQILQMEEDLSEIVALVGRDALAESDKVVLAAATMIREDCLQQNSYTSYDAYCPFLKSMLMLRNIVLWYELAQKAVAEVDRDAGATSASNRLTFAGLRDVQMDLLNRLSRMKFLEPSMGDDALRRHLDALRDDIVKSFRERDWALTA
CMF058C	probable zinc transporter	MLGEEQPLLRARGPMSDATAPEQAQKLWQQQREQRKERAARDQRARRKLLFSAVLCFAFMVAELLGGYITGSLAVMTDASHLLSDFASFIISLVALQKSQRRANQLLTYGYGRAEVLGAFTSILLIWTLTAVLVLESIRRIITPEPVKGRLMFIIAVMGICINLVMMTVLGHGHGHGHAHDHHHDHFAQVNAEAESSTSEEHRSHGRHRHRQRSGNVESIEPDQAGPSESGLNRPRDQQPGHDDMRATATDDIEAPLSVADMSHRHPVSESVNVHAAYLHVLGDLIQSIGVAIAALVIWWRPSWSLADPLCTLLFSVIVLYTTLRMIGDIVQVLMEGTPANIRVRDVYEALISIDGVSEVQDLHIWSLSVGRTALSAKLRCDASVKDAHQITMAAEQVCLKNFGIEHATIQVNCVNLSCCPPVEHVECASPGRM
CMS401C	unknown ABC transporter ATP-binding subunit	MVISTQGNVSGSVPNTLRAKPEQTLQASRPATRAVSAALDFCAGVAAAVSGISVPGGYFPPFMSFSNRLSPKAGTDTLSVSNQESTREDADAVLSTAAASLATDLEYGSATERHHENIDPIRPVTRDSGAFVENYPSGTREVAIAFEGVTLSASTQAAGTTRPILRNICFEVRDGETVFIIGPSGAGKSRLLRLVNRLEEPSGGQVRLWGTPVPAYPPGELRGKLVGFLSQQPALPCLAHRRPGLLEALRRLVTRETLWELVLGKRRQRSSANTEEPAKSALETLVRLGVVSRTELEQRLPEALHIAGLSRTILDRPLAALSGGERARLGLTRVLLQQPRILLLDEVTSSLDAATAAQVLQRLSDWKERIRATILIVTHRLSEVTDGQLILVRDGELFLRGDARALLGTADTAASIHRLLTGESLGATK
CMC151C	probable V-type ATPase V1 subunit C	MAPTGSPNEVCAGLLAVPRTLPTIPIAQIEPFELPGFRVGTLDSLLALSETLCRHDSAASQLAVKIAQEFPAEFSLSTDGLRVPLRAYCPFRWNQAKYGSVEQCPLAQLFQFVWRQVEELEQGFRTRHEQYAAAKQNWQALEQAYSGGLSYRPLSSIVRPEQILETEHLLTVFLLLKARDEDTFLRTYESSTPHVVPRSATLLARDDEEVLYSVVVFRKGLTEFVRAARERRYQVREYQSEADSTQGSLEERLAKARIHWQQLGHAFREWITEAYAECIDALVHLKVLRLFVEGVLRYGVPVSFAAGWILYDRSKIQKIRKTLQQALHTPEHRQILRHVYREAGEQIEMPSIPGLSAADMELPYDEDAFVWLPVDDAIFRQ
CMO274C	V-type ATPase V0 subunit d	DMLTFNADNGYLEAVVRGLKASLLRRQDYTNLAQCESPEDMRTILNSSDYGLWLQNEPAPLQTQALYDCLMNRLVYDFRSIRGQSYAPLSTFLDYVTYPYMIDNLVLLLMGVLRNRDLSELLDKCHPLGLFEGIATLTAIHSPEELYREILVDTPLAPYFAECVNVHDLTEMNVEIIRNLLYKAYLTDFYQLCVERIGGMTGSIMATLIAFEADRRVINITLNSLETSLRKDERMMLFPRVPGGLDDEIIQRLGRADDLQAVAMALDLSSTYRALFQRAAERGEYSLEDQFLEFEMKLLRESFDAQFHYGVFYAYFRMLEQEIRNLTWIAECITQKQFAHASRVVPIL
CMT466C	similar to transmembrane calcium/manganese transporter Ccc1p	MQSQRDVENGTCWNPDTAPYSAVGETTGLRAPELAQLAATGSVRHQHPVLHSSRARQLILEAHHARHQEKHSDSSGAVQDAILGAADGLTVPFALAAGLSGAFTKSSYIVLAVLSELVAGGISMGLGGWLAGRSEVQTFESEREREEREVQHTPLAEEAEIYEIFRPFGVPESAIESVLAHFREHPRDWVDFMMKFELGLSEPDRNRPWRSALTVGGSYVLGGLVPLIPYLLISDAREALMWSILFTFLALLLFGWVKAGFTGQSRWKSAIETAAVGGCAAAAAFGVARWFDSLTSLST
CMQ010C	probable V-type ATPase V1 subunit E	MNDAQVQQQVQQMVAFIRQEADEKVNELRTKAEEEFHLRKLSLFEEQRERIRAEFERKYKQLQASRRIALASALNAARLQVLRAREATLRELYECSRERLAAFGTEAGPDYQELLERLIEQGMKMVQPEPRVSLILRSRDRALVENSLAGLQARYRQLLENSEATTPASEQASCVSISNTEQLDNSSPGGVIVTSADGRIRCDNTLERRLEIAYQQNLATLRDLLYGDSGTLSAFEEDLSL
CMQ323C	V-type ATPase V0 subunit c	MSATSHACPPAAAFFGFIGAASALVFSNMGAAYGTAKSGVGIAAVGVLRPELIMRSIIPTVMAGILGIYGLIVAVILSGQISLQSYPYYLGFAHLSAGLAMGLSGLAAGICIGVVGDAGVRATAQQPKVFTGFILILIFAEALALYGLIVALILGGKTAPGACT
CMH200C	similar to V-type ATPase V1 subunit G	MSKERTGLKMDGGLGPEANKTADTVRLLLQAEAEAAERIQLARKEREDRLRLAVSEAEKDIAAYRERKEASFRQMQAELAGTTEGLGQKLQEKAEQLINADRARTAERLATAVDALVQAVLRCEPDP
CMQ375C	hypothetical protein	MSGDSGLPAPGRRAEGAPIGDVTAPLPSEVKHSEGQFDESRLASIIARLQDWDQSLSRLRRLCALLESEGEQARGELWALAASTDSLANSVRADLALLSTEQEKSFMRPGQAGAVLRLHKVRRDVERLSRAHANVMELIQDLESEVSEWGMDTQPELEVVDPQIPAVARSEYQHQTVVPSGRAATQTTPKRTSPATSPDRAEPYGTFETDQRRSAAQTVQVAAESEEAQLQARYDAQYAVHDMQERQTLLQRIQNSVQQAHAIFLELASMTEAQQQPLDDIEARTQRVRCEQESTAEEWARFARRRRTRRRFCFWFSIWMTLVLLFTIYVLFH
CMJ056C	similar to vesicle transport v-SNARE protein	MPQVSGDLRRYELELSHVIESANADISSLASEAGAEARRHVVSRITHWLRTANDLLARMELEAKSTEGDDLDRAAAESVVSDGRQRVVRLRRSLRGVEQALQREELISRSQQSSGPRVAREVDATDAPLLDTTKEHRAGVAGVTDTLVKASLHIQDSKRVLAETESVGANVLADLEAQGRTLERSYSRLQSMGSRLLSSSGIISTMRGTERMRRLLILGLVGAVLLSIGALMTIKVWPHKGGVVDGN
CMD062C	small GTP-binding protein of Rab family	MSVRPDDEYDYLFKIVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSVQTDGKVIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDISKRSSFENAERWLKELRDHADQNIVIMLVGNKSDLKHLRAVTTEEGQQYADARGLSFIETSALDASHVEEAFVRILTDIYRLVHKRHLASGDPTVAKSASGAVYQAGRGETISVGNLSHDNRSSKRKCCS
CMQ074C	small GTP-binding protein Arf1	MGLTLSRLFARLFGKREMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSNDRERLPEAREELHKMLAEEELRDAHLLVFANKQDLPNAYSASEITERLALHTLRQRNWYVQSCCATTGDGLFEGLEWLSQQLDDKY
CMQ198C	similar to prenylated Rab receptor 2	MAIQVSPNGGAASSVSSTAVMEAPGVLGSLLRRLPTGEDFRARIGDLWTRSRPWNEFFNTAAMNKPELSELRERVSQNLAYYAYNYATIFAVLVVLMVLVSPLSILGALAIFALYTYLFALNPEPITALGDRVVLDSRGKSVVVLVFSLVILWLTGAGATFSTLLFVVATIAIAHAAIRKPPGEADFESGIPGA
CME186C	long chain acyl-CoA synthetase	MSLNKELRSIKKAGSQETSTESAVYVCGYSMEPILRRPFPDENVPLHTLYDMFLRGCRKSGDAAHCLGYRNKQRSGNYDWLTYGQVREQAVAVGDALVRELRLQRGDRVGIYAKNCKEWMIVLLACSSRGLVPVPVYDSLGANSAAYVIEHSGMQVLFTSEENLERARSAVGSREVQLIVLDAYKPMDSLMTFQDLLEKGSAEHAPPDSTESDDDELMVIMYTSGTTGTPKGVMLKNEALLAEVAALQRATDAFQIPIGPGDVLLSYLPLAHIFAQAAETLWLVSGASIAYYGGDVKHLVEDIMDVKPTVFIGVPRVFARFYEQVQSTIAERGLVARTLFRIAYSMQSANVRAGTRSRIWDRLLFEKIRERLFPRVRFFFSGAAPLAEHLNIFMRTVFCAPMLQGYGMTETTAGAFVGSPTDRPDSVGGVMACFEFKLVDVPEMKYTHRDKPCPRGELWLKGPALTCGYYKNEQATKEAFPNDDGWMATGDIGRLNRDGTLSIIDRKKNIFKLAQGEYVAVEALESEYQKAKGIGQIWVYGNSMKSSLVAVVVPDPGYLRRQGLIAETGQLTQLSPSTREKIKQQLLKELQAQAKASNLKGYEYVKAIHLETDLNDLNQGFTIENDCLTPTMKLKRPQLLERYRKTIDQLYKQLGE
CMT369C	similar to O-demethylpuromycin-O-methyltransferase	MSSIWEQMRSLLFGASGSYADAADTPQGLAFEQRLVARHGNTLPPWPLFKLGAVYGVGPVPPNLRALLDGSFFLIGACLGTAALFDFAGIIGRRGGGVTAAEVAKECNCADVNAVGRVLRACENWGYFESYVPRDCDSKSVSNEQRLWRNTLLSALLREDHPHSVRAQIMHLYVDIFPASALLFETIRDTPSNDVETDGLRARADASATKQPSAFERVHQCTFWEYLSSHPDRWDVFNRAMRSSDALLGSTIMKDIDWGRYLRVIDLGAADGSLVYHLLSAFALKAVIFDLPPVIEHAKAYWNTSPERSAMVASGRVQFAAGDLFDATTVPAAEEGDIYVMRNIWHDWRDPDCIRIGRSVRAAIGDVRNVKLVILEASIDQYPRGSLLERFRVALDQIMFTAFRSKERDRIEFDALLRRCGFQLTEVRHLRASLVAVIAEPLSHWVQSPEPADQ
CMQ337C	2-isopropylmalate synthase	MWQAYATIAFCGPSWTSHRTISSVRKECFGHVSDQASRAAFTFPFASRRGVPRAAGRPRSRGLGGLRTRDSLQRLLMIGNAVSDASARAERPVVRVPVKPTAHDVATGRDPERVRIFDTTCRDGEQSPGAAMNAEEKLTLARQLAALGVDVLEAGFPAASNGDFEAVRRIAEQVGNRPNPPIICGLARATAADIKRCWEAIEVAAFPRIHTFIATSDIHLEHKLRKTRAEVLDIISEQVRYACSLCKDVEFSAEDATRSDPEFLYEAFRRAAEAGATTLNVPDTCGYITPNEMYTLIRGIYENVPGVRTGDVILSVHGHDDLGMSVANFLAACEAGARQVEVTVNGIGERAGNASLEELVMALYVRRNYYARVFGRDDIASGHSDRQLTNIQFREIAKTSRMVSSLTGMVVAPNKAVVGANAFRHESGIHQHGYLRNASTYSILSADTVGATTNAISLGKLSGRAAFRARLTELGFELSDDDLNRAFLRFKELADRKREITDADLEAIVSGGLKEIGVEHFKLKRVQVQCGSSSIPTATVTLLVMETGKEVTVPRTGTGPVDAAYCAVNAVVAQHGLDIELLEYTVSSVTSGIDSLGEVMVRVRDRRMDRIFTGYAADTDVVTASVQAYVNALNRCSRNTNTPQPIHPQHSSA
CMO318C	similar to glutathione S-transferase family protein	MITLHYLNQSRALRVWWLLEELEVPYDVKRYQRDETTMLAPAELKRVHPLGKSPVIEDDGQVIAESGAIIEYLTGKYDKKGLVPPAGTPERLRYTFWLHYAEGSLMPPLLLKLVFNRLATGPSPWIVRPLLRVISRRVQESFVDPQVQLHLGYVEQELTRYRWFAGDQFTAADIQMGFPLLVAKSQKALDDRYPHIMDFLKRMRERPAYQRALEKSGGDEI
CMP286C	hypothetical protein, conserved	MSAPSERTALLKQFASAIGSGTPETRLPPSQTSFQAGASGAPAAGTLPTPNEIKLDLSQPAALGAGTTGPAHVSGLVAPSAAGGGVGNPSGAAPTPTMPLPRKTGLRHRARLEREEPLREKAALGFVGRLSTYCTCTTYDLRALYAALQQITSKANLTVRRLSRDLLLLQRRPSRRRIGAIRELLRSGEDARGSRLPCGNDRSGDEHTEMLPTTASPPNDQQNRAGLARQRMNRTMDPSWRTMDAEEALDPSFALDDNQEVEDVVAGAAIFFFSYGTLVCWGLSEAGEWGILDWLQAFENGQLSPAEMEKEFFTYTYSYEADKARIKNDNIMLPGALVERSQLVGMRIAAPPAAILDPNAEAENEWTQLEEADLSDEELVQVQAGISHALAQSCKLGSFENSVDLLIERCGNVPLDLVRFGELRLGARDVMRMSGEVHLYRSYFNLQTDLLGTPDWFWENEEVEPLYERTARWLDTEKRGQLLNQRLEILKDLFMLFRDEVHVRTEHRLEWIIIILIVAEVLLQLLAMALGAAQSTA
CML244C	hypothetical protein, conserved	MAATEDSQNETLALFKNIAALDDNEVARAILSAHNWNIERAVDAFLTRGVEGALQPPNRTGSLEFASTSDTSGTTPDASELSSAPVSGQLHASRLSESQPLTPALAETSTPERALQPALAQATPSGVLGHLRRLLALPFQALRMVLAWCASLVTRIMGIDRYYRYAGRSRAVGAAAVAELEENLRTRYGMTIRYPTIYHGTFKEALEHSTQRCKLVLLYLHSEIHHATDRFVREILSDESFIQFVNENFVFYAASVNRSPEAVELASYFTPAGYPYLAVVFASRRWPLGQLIDLRVLSDLDRSMRGGRDAPITATDVLLWLQNVLLEYGDALRTAHTMRERRRSAQRLREEQDREFQEALAADQAAERARREFEQRAREEAAEQDQRRRERMAMLDRKRAALGPEPEPGEHVVTVLLRLPDGKSTQRRFELSRSFRDLFDWAETSADIDFDRFELTTNFPKRAYSPASHSAMTLAEAGFKQRVALLVTEIGWTRALPDASGKADVSDGNGNVEQKHLEQGNSSESKKQV
CMT524C	hypothetical protein	MTSEALETKRYGKRPVECLVLACTRAGKPFFFWSTRQWPDWQQRRLVVSLGASAAALVARLEHKLRPSYGKRSNRYLVEGERRVWCLDLSIDDCVLLAGVRSPGGPASAPQCQLREPSVYRCLCLALQSWLRRVLLSQLPTSVFATLHVRPAFDMHPYIDSDSIGSVLEMVLHHPLVCIRDLLPLSGPLLYPSQRSSLMDSMQRLIKLVEERARPVRVSACLLVDVVANGMMVARISMNVGAPLYLIMLGLVRVLHAESCVRLQTPDYEPLYLVAGGSGRYRLIYALCRAVAPQVLDEEPIRSLQASVLQTAAVQHAQAHDRLLVNLIDSLTPADLERDIGTAALAAWLPERHTKAPPFALAAIFQTSRRFVSVHIDDESHWWILAAYRLYEQRQRSSNVRHAPFSLKAPTRRLSCFPNRSCYGEQCIVFVIFELSETGSGLVQITDQVPAIVQMIADRWTGHLLQLSLHHPILRSLDQEPEWYLWSGLCRLYAR
CMO027C	hypothetical protein, conserved	MLKRKLGTRLFVGPTLVLVQQRPTPANTCARRLCCKSREPAARRHCKVTLALSEHPLRQTLFSGDMRTSTASGNNPARQTVQLVHRLQRLFVSIRSAVRAPLLSRTDGTSDLERLRPQQSVLASKERGELHVSCLSSTACSPSNTDDTAGHDCDIGRTREADQRWGVAAPLTEVTAASSEFQYRSSEEQLQSSGRAHRSRVVLLCGIPGSGKSTFAKLVLKHGGENWVRVSQDDLGSRQECERMMQEALTSDPPRHVIVDRCNVDSAQRAVWIAIAAQANAYPVGVLVFPVPLDECIRRVLLRGPNHPTLFESTENDVVKVVTSFAGKWENPSPGEGIGFCRIVASPADEERVMAELLC
CMC079C	hypothetical protein	MTNDANHLESNCVEEQVQQSLREPWWWLRWRDTPRQQLRGTLFVYTATCPDEKIQRERGFAADHEQVYAFVSFGPEVETDPREHVVEIVKALTSMRSFVETLERTLFEDEDSEPAARTYTHDEPCSVAHHSADADQQFLVETVRHDRIAAAYSSMSQEMHTAPEGARPDCFSKGTSQDHETDTSQPILRKKDETDTWVVALGPDHLVASHTLAACGCALFLGLEWDFRACRSRSDDDFRIMELFQEDLKSRVTWLAPRLGLQHKHACSAQCKDQARNRDSSWDVLLREWLPQAIPGGPRHPQAM
CMP062C	similar to TGF beta receptor associated protein-1	MSEQTPLLSQRSPEGVPEGAGTRAAPGRAASAQITGGLDYDFEEDDLEAGSDDENPEHAQHMWPKTGPNSTGSSFVERAAQTVTDFVLGERSRTPIAGTSSTPPEHSTQLTRDTDEDDRRDDGDAGAKKKKKKSKRKERDVDDIEACPYDTIESARKPVKGDDLKTHMANERTFFKWLFTGFHIGAMGTFILSFYSDDSGRPGTGKILLCLAIWMVALVYVMYGLINFYRRRRALRQGLGKEEWDSGAGPAYVVAGLVLVIGSVLVYSLVTGQAPRRWQQAQT
CMD042C	hypothetical protein	MNWMWETPALGAAVALVVFAVAVRGLLFKRDPETRVPTRTGAALREENSSRPQRLVHGPPLQPPVSETSTPQRVLGAPRVVITIVEEVTSKSLWVHGESLDWAPWVPEWFRRLALLHFVDVYFILRVRNDQDCSLWYQQVGALCRSPAGQILDERKFLVCDTAAGAAAMVRQLEPSLHLESLRLASECAVRLHRFIPKIIILAHEPEHTGIEPSTVLEQFTRHDTQRAPFRTAVAVLDDPMAMFANPLWQEVELQVRAGIQCPR
CMD066C	hypothetical protein	MPPPNDSQRYFEEGPVLAHRTDWKPIAERSTAQRPEPALQATTEAPSWWRQVTRRGARVFLFYALLYPLLVLCVVGGIVGGFIGGFWLDWHAIRLAGNAWLALVSIPYATGFLALLWLMRAESFRGASAGALSFASNALGNAASRCTARLLLSLSISGSLALPAFLFLSRRVPADAALICTAGTAVICASLALWAFVLESDWLEPRTWLEPTAPSNVWIRPSYWPRREHYIDLEAAPTRTGG
CMJ260C	similar to prenylated rab acceptor PRA1	MGVPQITSNTVAPVERKVERGSYGATAPAAPAAAFASTESELIRDSDPSLSTMWLPVDLSVQLTPKERLQLAWSAARPWREWAALHALAPPPPSSWLDWSARVRTNLELYAWNYLFVALVMFIVTGLFYPWSALLLISWLLLALYMGVRTADAVGGEDASLGARMFQNWPGYIRYILLGGLLTLMLFLTDVVALALTSASLAAAVTLAHAALHDPVAVLSARNAEYTVAP
CMN188C	similar to steroid binding protein	MDAVGLWLLLGGGVFVLGALRLMGNHVENPAVQPPPRHHERPAPRAFTGEELAQYNGTKGQPIYVAVQPRPGARAEVFDVSDARSFYGPGGPYFVFAGKNASRGLAKMSTEPGEVCGAIDDLTEHEKETLYQWFEKFLQKYEVVGHLREDPSGSGSSTNCTA
CMT579C	luminal binding protein BiP	MATRRFSYRRVSIWNWALVAVLVHVCCCLFGRAVLVGAKDASSGGGKIEGPVIGIDLGTTYSCVGVFKNGKVEIIANEQGNRITPSYVAFTDKERLIGDAAKNQLALNPERTIFDVKRLIGRRFDEETVQKDIKLLPYKVVNKDGKPYIRVEVRDGEVKTFSPEEISAMILGKMKKIAEDYLGKPVKNAVVTVPAYFNDAQRQATKDAGTIAGLTVQRIINEPTAAAIAYGLDKGGSEKNILVFDLGGGTFDVTLLTLDDGVFEVLATNGDTHLGGEDFDQRVMDYLVKQFKKKNDGLDLRTDKRAMAKLRREVEKAKRALSYQTQVRIEIESIMDGKDLIEELTRARFENLNMDLFRKTLKPVEIVLKDAKKEKKDIDEIVLVGGSTRIPKIQELITEFFDGKQPSKGINPDEAVAYGAAVQGAILSGEGGETTKDILLLDVTPLSLGIETVGGVMTKIINRGTTIPTKKSQIFTTHVDRQSSVLIQVYEGERVATKDNHLLGKFELTGIPPAPRGVPQIEVTFEIDANGILQVSAEEKTAGKREKITIRNDKGRLKDEEIQRMVREAEEYAEVDAKLKRKVDAKNNFENYIYQVRQMYEDKDKKTKLSTDDIDKLKDSVESAQDWLDEHGEASDAAAIEERMKAFQDVVQPIILKTYESAKGTGKDSSADSSADDDRDSEEHDEL
CMC046C	hypothetical protein	MTMAAGNPWSLQVQEDQVRLRVSVPRRTPEQRLEIQATRTRVSVSVAGNKDRPPTDIILPNHVRIEPQSADVFYKSRTGTLWLHFRRAASVGPAKRAAPNETSQETAGRCERSAPASQQSLANTVEQTPESRKANPKTLSESLVTLHTAAEDTGPESQSAGSTKDETCHSSCEVPEPKRTRLGSSTPKPAVEGAQAGSAASPWPATPAHEPSNQQDFAELAANFPPLTKNTSELASSGDTSSDVASHGSSELVPGLADFLEHASHPQILRALRQVRRLYLSRTADPGALWRRIATARNNATYARTLLREMMHAVVLQGTGQEIRRKQRLAALIKRAKSGVVKDESHQRADRKWVDKHTEQTVAHRVASMLEQSISDAREKEFAHAAALAAKAQERKTRKLQKLAWQTALARRSLESRRRSEAHENTGRCPAPITQRAGKSRARVSFLLDGKQVHFPA
CMB072C	similar to cell polarity protein tea1p	MVAAVCVEWSKLRSSHYPLEPRYGHSAPSFFNGTTDLVYIYAGRGFDATPFGDVFLFDPVSESCRSELADGSVPAARSFQAAVVAGHRLVVFGGLTADADASTTTADSEALTNSFYLLDILRRPMNWADRMQVIERSPLYRMSSLWPSGWGRGIIPIQKQAISMTRRGQQILYFGGDIGNGVYSRCVFMFDFPKSTWNILFPTRMGASCAESGPPEQDSTYPAARAAAAAAPFSDRDSLYFGGSRASINGSSTEYRVFNDLWIFRTASGEWQNVPPSADSQALPLPREGHTLTRAPSWLSQYPSWILFGGRTCSGNRTACHPGELVPLNDLWLVHIDGRGAANWRRLQECNSSAASDTPLARSFHTMTLVNDESLVLIGGLGNETVFGDIWRMRWRQRPLEAPARALRGGLPTTPGSLPMYVLIYFPKLSWYAPEQFTVAIDSSLRRGVQEILASSSIPLLDIVLYETASGGGGHGKTLARGTLAQYIMLIGPAFAGRFLSRIQSADLAKYLTSETGTPVRVMGCSSRNALSMNWKQLGDKTAPSSGNALDTAAIASIVTVASAAVAALIVGLLVLFIRRRRRRRRMRRISRNDMTPGRIELGNSSPS
CMS128C	ATP-dependent Clp protease, ATP-binding subunit ClpB	MTSPVTMVALVLRTLRNSSKAPWGGAALLGTSVGRSESWPRALVGDAPAGPLLHASRSLRRWHSVRRLTMFFNHQAGVLALSERCRRLESLRGAVLNRFNVSSRNLERVVGIRGFATGMGHTNDRTGATGQPPGWVHPENVPVGEALKKYGRDLTSAAALNRLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQRIARGDVPESLKNKRVVALDLGALVAGAKFRGEFEERLRSVLRDVEELQGSVILFIDELHMLVGAGAAEGSLDASNLLKPALARGDLHCVGATTLAEYRKYIEKDAALARRFQPIFVAEPSVEDTINILRGLRNRYEVHHGVRIADRALVAAAVNAHRYMTERKLPDSAIDLVDEAAARLKMQQESKPEAIDDLDRRLIRLRVELEALRLERDPVSRKRLSAVEGEVRELEHQRSQLALQWERERAQLQAMKQAKEELEKALHEMEMAERRGEWEKVAMLRYKTIPEIESRIPAEHRTILLSDSAQGTTATTLNVAQNEAETSGKLVAEAVTEKDILQVISKATGIPVQALMSSEKERLLHLEDHLSKRVVGQPEAVRTVASAIRLSRAGLHAHNRPIGSFLFLGPTGVGKTELCRGLAEFLFDSPDAMCRLDMSEYSERHSVARLIGAPPGYVGYEEGGQLTESVRRRPYQLVLFDEFEKAHRAVCTVLLQVLDDGRLTDGQGRTVDFRNTIIVMTSNIGADILASLPDGVPSSFARDEVMVQVRQFFPPEFINRLDDIILFNRLGREILKDVVRVQLDALQKLLRERADLRLDISDDVIQWLVEHGYDPVYGARPLRRVIQRAILEPLSRHLLQGTVRHGEDVRVRISKQAESLSGATLEIEPNHDVGEAKKEEHDL
CMP123C	V-type ATPase V1 subunit B	MESTKVESHRFEDVKPRLTYRTVAAVNGPLVVLERVRQPRYAEIVTITLSDGTRRRGQVLEVNGDRAVVQVFEGTYGIDSGGTVIEFTGDVLRMPLSRDMLGRVFDGSGRPIDGGPAFLPEKLADINGSPINPQRRMYPQEMFQTGISTIDVMMSVARGQKIPIFTSSGLPSDVVAAQICRQACLVRPPGTKKNDANDDQFAIVFAAMGATQETARFFRRDFEENGAMTRTVLFLNMSSDPTIERIITPRLALTTAEYLAYDCGLHVLVILTDMASYCDALREVSAAREEVPGRRGYPSFMYSDLSSLYERAGRVEGCKGSITQIPIVTMPNGDITHPIPDLTGYITEGQIFLDAALHSREIYPPVNPLPSLSRLMKSAIGEGMTRRDHSDVSNQLYAAYAIGKDVMAMKAIIGEEALTAEDHLHLDFLAKFESKFIHQGRNENRSVYESLDLAWSLLRTFPAHLLKRVSQKILDEFYHREGVMDGPLNKKP
CMS270C	chaperonin containing TCP1, subunit 4 (delta)	MNNHQATALIRSGQQGRTGDNSTSATTAKARDVRVANIAAAKALADAVRTSLGPRGMDKMIEGARGDVLITNDGATILDRLGVQEPAAKMLVNLAKSQDIEAGDGTTTVVVICGALLAASQLLLERGIHPTTISDAYQSACTEALRIIDSIAVPVSLSDRDELVKLATTALNSKIVSQHASLLAPIAVDAVLHVAERRFIESEATEAPPQAVDLSRIRIIKKLGSTIEDSFLYPGLILTQSVVKSAGGPSRIVNAQVALIQFCLSAPKTDIENNVVVQDYAAMDRILREERQHILQMCKKIKATGCNVLLIQKSILRDATNDLSLHYLAKMKIMVVRDIERDQVGFICKTLGCVPIAGLDTFTADKLAKVDVVEEVALDSGDEKIVRFVQGPAAAATAAALASNTNGLSMLPDGSSERPAFWTSLPAGTSNLPQTMTIVLRGSNQLILDEAERSLHDALCVVRSLVRKRSLVPGGAAVETEVSVRLGEWAKTLSGAKAYCVKSYAEALETIPYTLAENAGLNPIQVITELRNRHVRGEKSVGIHIRRSGGVVANMLSEHVVQPTLVSSSAFTLATEAARMILKIDDIVVTR
CMN032C	similar to isoamyl acetate-hydrolyzing esterase	MASEQPAGVEDPAQAHDAATFNQSEERPVSALASQQRLPWQLRWQRTFNALGGVVSRAHGGITEQFRALFARRMAAATPVLLFLGDSLTRRGLDINEYAGYTSVGWGLRLVHAYNGAADCIFRGLSGYNTRWALPVVRHHLSDVAQERLLLVGIWFGANDAAAPGTAQCIPLDEYASNLYEMLRLILERSHDASLTLTSERHPRRQQHGRTPPSLAAAPAPDASEANEIESVRYPRVLLMTPPWVDEEARRRHIQSSLAAERAAPDAHQPSDSGQRTESDRMCARTRQYAAACRRVAAQIRPRDRVLLLDLFTQIEQLPPAERSGLFIDGLHLSDRGQRFVYDAILELIAREAPELSPSSLGQFAIPWCDINPVRPQEQLAVYDQQRWW
CMS019C	hypothetical protein, conserved	MASEQPAGVEDPAQARDAATFNQSEERPVSALASQQRLPWQLRWQRTFNALGGVVSRAHGGITEQFRALFARRMAAATPVLLFLGDSLTRRGLDINEYAGYTSVGWGLRLVHAYNGAADCIFRGLSGYNTRWALPVVRHHLSDVAQERLLLVGIWFGANDAAAPGTAQYVPLDEYASNVYEMLRLILERSHDASLTLTSERRPQRQQHGRTPPSLAAAPAPDASEANEIESVRYPRVLLMTPPWVDEEARRRHIQSSLAAERAAPDAHQPSDSGQRTESDRMCARTRQYAAACRRVAAQIRPRDRVLLLDLFTQIEQLPPAERSGLFIDGLHLSDRGQRFVYDAILELIAREAPELSPSSLGQFAIPWCDINPVRPQEQLAVYDQQRWW
CMS022C	hypothetical protein, conserved	MSLQTPPHYRRPQGMRSPLAYEKENVRLTPNNLTRMNESFATPFKELANSPMRLEDKALLVKRIQEEAYKAKQLKLLNATLISRLRETTLELEGNRERLHQAEQRVTHLDQQVKTLEAQLHDKDVDLVSVSKQLALQEQANRELQAYMRELEELRLEVVALRESKQQVLVDMEGLRFEKDHEMELLQNDMEKRQQARERELAELLETVATLRREQAQLRSTLETIECKKNEVALTLDRMFGEVRVYREACQLRDQENQQLRNRNLELEGERTQLLLEIERLGKQIEALRMDLETTRLKSTLYYKVRSLLGNLFTYFTRSN
CMF012C	phosphoenolpyruvate synthase	MVLTNCEENDAGKYVVELQNLRNTDRGLVGGKNASLGELLSLGLLVPRGFAVTVAAYESFIEFNKLDTKIQSILQGLNLESPSSLEEASKAIMALLEDAAYPPPVEQMIRSAYRNLVKTLGAQEPLVAVRSSATAEDSAEASFAGQQETYLCVHGIDAILQYIKKCYGSLFSPRAIAYREEKGYPHLDMRLSVGVMQMVQSRVSGVCFTLDPVTGKRDLIVIECCWGLGEMVVQGRVRPDRFVVEKASGRVLERHTASKPLMMVRAAVADGVQGIDAASADTLTREVPVPADLVEAPCLTDAQIQELLRTALTIEKHYGIPMDIEWAIDEEKNQLYVLQARPETVWSDRKAASRREVLVRGLGASPGRAHGKVRVLLDVQNISEFQPGEVLVTSMTTPDWVPAMRKAAAIVTDSGGMTAHAAIVSRELGLPCVVGTGKATEILRSGQIVTVDGTLGVILRGVHKAEEDTPPKAGISADAVASMVLPITATRVYMNLGEPEKMQDLRHLPFDGIGLMRVEFILASWVGHHPMYIIENKEEEMLVEKLAEGISMVAQAAYPRPVIVRFSDFKTNEYRSLKGGERYEILESNPMLGWRGVSRYVSAEYEAGFRLECRAMKQVRDEQGLKNVWAMLPFARTTWEVQRALDLMRSEGLQRASDFKVLLMAEVPSVVLLARDFAQLCDGFSIGSNDLTQLLLGADRDSPKLATLGYFDERDPAVKAAMRILIEEAHRANITVSICGQAPSVYPDLTEFLVRCGIDSVSVNPDAVISTRKQIASVEQKILLENARRALLEQHSTGR
CMC066C	signal recognition particle SRP54 homolog ffh	MQTAFQVHVCWSRTSRNRQLRAVCPGRNSRGFGPQASTGCSFRHKSAWLGSYDRAGIATARVLHLEREQVAFRRFHALRGSPHGFAGTRMLFEALTENFQRSLAALRGLDKITETNIEPTLKEVRRALIDADVNVKVVDILLAAIKEQALNMKVVKGVTPGQQFVKIVYDELIRLLGGDPATSSSKAGASPLPALAESPTKPTVILMAGLQGAGKTTQSAKLARLLQTEKRSRKKVLLVAADVQRPAAVEQLQTLGQQIETEVFIPAMVGTGSVTALEVATRALDYAKQKAFDFMIVDTAGRQVIDERLMEELQQIKRVLSPAEILLVVDGMIGQEAANITRAFHERIGITGAILTKMDGDTRGGAALSIKQISGAPIKFIGVGEKLDKLEKFYPDRMASRILGMGDIITLVERAQEAVDEKEAEQLARKMLEARFDFNDFLRQTRFVRSMGSFAGVLKLLPGVSGMLKEDQLRAGEKRLRLAESVINSMTPRERANPDLLTVDKTAASRMRRIARGSGRSLEQVESLMRDFVNMRNVMAQMSRRMMGGGSGAGPVPSNASQNPGDLATNLASGDLASNIGNRAARRKLNKKKSDASSSKKSGFGFKQ
CMR047C	hypothetical protein	METAPYLREPHVVLPSESVITEAVKCFNDAVDEALQPSVRESYLLPESRREAVREQLRATAAALEELLRKNCVVFAQVQASFPEEEEDNEIRGKVKTLEALIIEKEKYLRRLRAERCATAEQLVRAQAERLAQQVTALQAEAVFSNAQFEDLVSDNESDTELSDGRKRALEEQVLQRVETVRKLMSELLHRLPALKDKAERLREVAQSFGGVEPSETEIFIKEDVSNLLSFDICTENLRPEQPNTEVETRSSRASKESAGAITRARLAATLRVSGSVTRIR