Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Inhibition of full length recombinant human ADAMTS-4
Assay data:4 Active, 14 Tested
SummaryCompounds, ActivePubMed CitationRelated BioAssays by Target
Inhibition of ADAMTS-4 (unknown origin)
Assay data:4 Active, 2 Activity ≤ 1 µM, 4 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMPubMed CitationRelated BioAssays by Target
Inhibition of human ADAMTS-4
Assay data:1 Tested
SummaryPubMed CitationRelated BioAssays by Target
Inhibition of ADAMTS-4 (unknown origin) by FRET assay
Assay data:1 Active, 1 Activity ≤ 1 µM, 1 Tested
Inhibition of recombinant human ADAMTS-4
Assay data:4 Active, 3 Activity ≤ 1 µM, 4 Tested
In Vitro Assay from US Patent US10829478: "5-[3-[piperazin-1-yl]-3-oxo-propyl]-imidazolidine-2,4-dione derivatives as ADAMTS 4 and 5 inhibitors for treating e.g. osteoarthritis"
Assay data:28 Active, 28 Activity ≤ 1 µM, 94 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMRelated BioAssays by DepositorRelated BioAssays by Target
Assay data:1 Active, 1 Activity ≤ 1 µM, 2 Tested
AlphaScreen Assay from US Patent US9206139: "Aggrecanase inhibitors"
Assay data:5 Active, 2 Activity ≤ 1 nM, 5 Activity ≤ 1 µM, 5 Tested
Enzyme Assay from Article 10.1074/jbc.M112.380782: "Simple Pseudo-dipeptides with a P2' Glutamate: A NOVEL INHIBITOR FAMILY OF MATRIX METALLOPROTEASES AND OTHER METZINCINS."
Assay data:12 Active, 3 Activity ≤ 1 nM, 12 Activity ≤ 1 µM, 12 Tested
Immunoblotting from US Patent US10322143: "Inhibitors of ADAMTS4 or ADAMTS5 for use in preventing or treating cardiac remodeling and chronic heart failure"
Assay data:61 Active, 13 Activity ≤ 1 nM, 61 Activity ≤ 1 µM, 61 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMRelated BioAssays by Target
Aggrecanase-1 Inhibition Assay from Article 10.1016/j.bmcl.2005.10.001: "Synthesis and biological evaluation of biphenylsulfonamide carboxylate aggrecanase-1 inhibitors."
Assay data:15 Active, 4 Activity ≤ 1 µM, 23 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMPubMed CitationRelated BioAssays by DepositorRelated BioAssays by Target
Aggrecanase-1 Inhibition Assay from Article 10.1016/j.bmcl.2007.07.048: "5'-Phenyl-3'H-spiro[indoline-3,2'-[1,3,4]thiadiazol]-2-one inhibitors of ADAMTS-5 (aggrecanase-2)."
Assay data:4 Tested
SummaryPubMed CitationRelated BioAssays by DepositorRelated BioAssays by Target
Aggrecanase-1 Inhibition Assay from Article 10.1124/jpet.103.059675: "Identification and characterization of 4-[[4-(2-butynyloxy)phenyl]sulfonyl]-N-hydroxy-2,2-dimethyl-(3S)thiomorpholinecarboxamide (TMI-1), a novel dual tumor necrosis factor-alpha-converting enzyme/matrix metalloprotease inhibitor for the treatment of rheumatoid arthritis."
Inhibition of human recombinant ADAMTS4 using synthetic peptide as substrate by FRET assay
Inhibition of human recombinant ADAMTS-4 (AA1 to 520) assessed as cleavage of fluorescent substrate using as TBIS-1 substrate incubated for 180 mins by biochemical assay
Assay data:14 Active, 14 Activity ≤ 1 µM, 14 Tested
Inhibition of rat ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay
Assay data:8 Active, 8 Tested
Inhibition of human ADAMTS4 using 43-mer [protein fragment, 43 aa] as substrate measured after 3 hrs by AlphaScreen assay
Assay data:8 Active, 8 Activity ≤ 1 µM, 8 Tested
Inhibition of human ADAMTS4 using [protein fragment, 43 aa] peptide as substrate after 3 hrs by Alphascreen assay
Assay data:8 Active, 2 Activity ≤ 1 nM, 8 Activity ≤ 1 µM, 8 Tested
Human ADAMTS4 (M12: Astacin/Adamalysin)
Assay data:1 Active, 1 Tested
Inhibition of full length recombinant ADAMTS4 (unknown origin) expressed in insect Sf9 cells after 6 hrs by alkaline phosphatase-based assay
Filters: Manage Filters
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on