Warning: The NCBI web site requires JavaScript to function. more...
An official website of the United States government
The .gov means it's official. Federal government websites often end in .gov or .mil. Before sharing sensitive information, make sure you're on a federal government site.
The site is secure. The https:// ensures that you are connecting to the official website and that any information you provide is encrypted and transmitted securely.
Growth inhibition of human MCF7 cells after 48 hrs by MTT assay
Assay data:28 Active, 17 Activity ≤ 1 µM, 30 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMPubMed Citation
Growth inhibition of human HCT-116 cells after 48 hrs by MTT assay
Assay data:29 Active, 21 Activity ≤ 1 µM, 30 Tested
Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintillation counting method
Assay data:31 Active, 25 Activity ≤ 1 µM, 31 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMPubMed CitationRelated BioAssays by Target
Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scintillation counting method
Assay data:30 Active, 30 Activity ≤ 1 µM, 30 Tested
Experimentally measured binding affinity data (Ki) for protein-ligand complexes derived from PDB
Assay data:3598 Active, 421 Activity ≤ 1 nM, 2233 Activity ≤ 1 µM, 3598 Tested
SummaryCompounds, ActiveCompounds, activity ≤ 1 µMPubMed CitationRelated BioAssays by DepositorRelated BioAssays by Target
Inhibition of CDK9/Cyclin T (1 to 330 amino acid residues) (unknown origin) by differential scanning fluorimetry assay
Assay data:18 Active, 16 Activity ≤ 1 µM, 18 Tested
Inhibition of CDK2/Cyclin A (174 to 432 amino acid residues) (unknown origin) by differential scanning fluorimetry assay
Assay data:14 Active, 2 Activity ≤ 1 nM, 14 Activity ≤ 1 µM, 18 Tested
Filters: Manage Filters
Your browsing activity is empty.
Activity recording is turned off.
Turn recording back on